Lus10004535 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44020 206 / 8e-65 Mitochondrial transcription termination factor family protein (.1)
AT4G02990 123 / 2e-33 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
AT2G36000 40 / 0.0003 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
AT4G09620 39 / 0.0005 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004614 277 / 4e-92 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10022321 115 / 1e-30 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10014877 114 / 4e-30 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10026571 42 / 7e-05 AT4G38160 252 / 4e-83 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G116700 224 / 2e-71 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 123 / 3e-33 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.007G001800 42 / 0.0001 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10004535 pacid=23159387 polypeptide=Lus10004535 locus=Lus10004535.g ID=Lus10004535.BGIv1.0 annot-version=v1.0
ATGAGTTTATCATTGCTCAGTAGAAGGAATTTGTTCTCTGTATTCTGCAACCCCAGATCTCTCTCCCCGCTACAATTTTGCCAAAACTCTAACCCTCTGC
TACACGGATTAAAGGTTTTGAATCATCTTGCCTCATTCTCCACCCAGTCCTCCTCCAAATTCCCAGAATACGAGATGCCTTCAGTCACTTGGGGTGTTAT
ACAGGGAAAGAAAGAGAAGTTAGTGAATCGTGTCATAATATGTGATTATCTCAAGACTTTAGGAATCATTCCTGATGAACTGGAGACTCTCGAGCTCCCG
TCCACCGTTCAGGTTATGAAAGAACGGGTTGAGTTCTTGCAGAGGTTGGGATTGACTATCGATGATTTCAACGAGTATCCTTTGATCCTAGGTTGCAGTG
TTAGGAAGAACATGATCCCTGTATTAGGCTACTTGGAGAAAATCGGCATAAGTAGGTCGAAACTCGGGGAGTTTGTCAAGAGCTATCTCAAGTTATGCAC
ATGA
AA sequence
>Lus10004535 pacid=23159387 polypeptide=Lus10004535 locus=Lus10004535.g ID=Lus10004535.BGIv1.0 annot-version=v1.0
MSLSLLSRRNLFSVFCNPRSLSPLQFCQNSNPLLHGLKVLNHLASFSTQSSSKFPEYEMPSVTWGVIQGKKEKLVNRVIICDYLKTLGIIPDELETLELP
STVQVMKERVEFLQRLGLTIDDFNEYPLILGCSVRKNMIPVLGYLEKIGISRSKLGEFVKSYLKLCT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44020 Mitochondrial transcription te... Lus10004535 0 1
AT5G50990 Tetratricopeptide repeat (TPR)... Lus10032531 2.8 0.7746
AT2G41500 EMB2776, LIS LACHESIS, WD-40 repeat family ... Lus10004167 4.2 0.8117
AT1G50600 GRAS SCL5 scarecrow-like 5 (.1) Lus10003773 11.4 0.7786
AT1G31814 FRL2 FRIGIDA like 2 (.1) Lus10042965 14.5 0.7378
AT3G20280 RING/FYVE/PHD zinc finger supe... Lus10013301 15.5 0.7883
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10028841 16.2 0.7895
AT3G23950 F-box family protein (.1) Lus10007303 20.5 0.7769
AT5G41950 Tetratricopeptide repeat (TPR)... Lus10018184 27.1 0.7632
AT3G22430 unknown protein Lus10041204 32.2 0.7444
AT1G51310 transferases;tRNA (5-methylami... Lus10039111 48.3 0.7049

Lus10004535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.