Lus10004536 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18905 182 / 2e-55 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT4G35370 177 / 7e-54 Transducin/WD40 repeat-like superfamily protein (.1)
AT4G18900 173 / 4e-52 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004613 290 / 3e-98 AT4G35370 384 / 1e-130 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10001126 229 / 6e-71 AT4G18905 427 / 5e-142 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10015348 164 / 1e-48 AT4G18905 527 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10037439 41 / 0.0004 AT5G15550 635 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10041271 40 / 0.0006 AT5G15550 635 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G019833 203 / 2e-63 AT4G18905 563 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.007G019601 202 / 9e-63 AT4G18905 566 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.015G110300 44 / 3e-05 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00400 WD40 WD domain, G-beta repeat
Representative CDS sequence
>Lus10004536 pacid=23159393 polypeptide=Lus10004536 locus=Lus10004536.g ID=Lus10004536.BGIv1.0 annot-version=v1.0
ATGAAGAGAACGAAGAGCTGTTGGATTCCGGGGCTTCAGAAAGAAGTGGAGAATTTCAGCTCTGGAAATGGAGACGTTTATTATCCCAACAACACAATGG
ACCCTCATATCAGGGATAACGATGATGATGATTCGGAAGAGGAAGAGGATATGACTATTAGGCCAACAGATGGAGTAATAGTTTGTGCACATACTGAAGA
TGATCTCAGTCATCTCGAGGTTTGGATATATGAAGATTGTGATGATGGTGAACCAAATAAGTACATTCACCATGATATTATCCTTTCAGCGTTTCCCCTG
TGCTTAGCTTGGCTTGATTGCCCAATTAGAGGAGGGGAAAAAGGGAACTTCATTGCTGTTGGTTCAATGGAGCCTGTTATTGAAATATGGGATCTTGACA
GGGTGCAAGCAGTTGCATGGAATCACCATGATCCACAAATTCTTCTTAGTGGATCTTTCGATCGATCGGTTGTAATGAAAGATGCTAGGAACCCTATGCA
CCCAGGAATCAGATGGTCGGTTACAGCTGATGTCGAAAGCTTGGCATGGGATCCACACAATAGACACAACTTTGTGGTGAGTGTTTCTTGA
AA sequence
>Lus10004536 pacid=23159393 polypeptide=Lus10004536 locus=Lus10004536.g ID=Lus10004536.BGIv1.0 annot-version=v1.0
MKRTKSCWIPGLQKEVENFSSGNGDVYYPNNTMDPHIRDNDDDDSEEEEDMTIRPTDGVIVCAHTEDDLSHLEVWIYEDCDDGEPNKYIHHDIILSAFPL
CLAWLDCPIRGGEKGNFIAVGSMEPVIEIWDLDRVQAVAWNHHDPQILLSGSFDRSVVMKDARNPMHPGIRWSVTADVESLAWDPHNRHNFVVSVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18905 Transducin/WD40 repeat-like su... Lus10004536 0 1
AT1G22950 2-oxoglutarate (2OG) and Fe(II... Lus10000171 2.0 0.7800
AT1G55520 ATTBP2, TBP2 A. THALIANA TATA BINDING PROTE... Lus10002634 2.0 0.7919
AT1G15060 Uncharacterised conserved prot... Lus10000099 7.3 0.7471
AT1G61770 Chaperone DnaJ-domain superfam... Lus10020062 7.3 0.7734
AT5G04850 VPS60.2 SNF7 family protein (.1.2) Lus10034131 9.9 0.7356
AT2G36730 Pentatricopeptide repeat (PPR)... Lus10040171 15.2 0.6760
AT1G16040 unknown protein Lus10032921 17.2 0.6917
AT1G65660 SMP1 SWELLMAP 1, Pre-mRNA splicing ... Lus10007479 17.7 0.7555
AT2G20280 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10023164 19.0 0.7112
AT5G50240 PIMT2, AtPIMT2 Arabidopsis thaliana protein-l... Lus10017776 21.2 0.7615

Lus10004536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.