Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03000 164 / 2e-53 EF hand calcium-binding protein family (.1) AT1G32250 149 / 3e-47 Calcium-binding EF-hand family protein (.1) AT1G18530 98 / 2e-27 EF hand calcium-binding protein family (.1) AT3G25600 97 / 1e-26 Calcium-binding EF-hand family protein (.1) AT3G43810 87 / 7e-23 CAM7 calmodulin 7 (.1) AT5G37780 87 / 8e-23 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT1G66410 87 / 8e-23 ACAM-4, CAM4 calmodulin 4 (.1.2) AT2G27030 85 / 9e-23 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT2G41110 85 / 3e-22 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT3G56800 85 / 3e-22 ACAM-3, CAM3 calmodulin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004610 [exp] 207 / 2e-70 AT3G03000 243 / 3e-83 EF hand calcium-binding protein family (.1) Lus10030986 [exp] 145 / 1e-45 AT1G32250 219 / 3e-74 Calcium-binding EF-hand family protein (.1) Lus10017900 [exp] 99 / 2e-27 AT3G25600 252 / 4e-87 Calcium-binding EF-hand family protein (.1) Lus10041288 [exp] 87 / 9e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 87 / 9e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 87 / 9e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10027283 [exp] 87 / 9e-23 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10022589 [exp] 86 / 3e-22 AT3G43810 255 / 2e-88 calmodulin 7 (.1) Lus10035383 [exp] 85 / 4e-22 AT1G32250 152 / 8e-48 Calcium-binding EF-hand family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G095700 [exp] 170 / 1e-55 AT3G03000 220 / 1e-74 EF hand calcium-binding protein family (.1) Potri.001G138000 [exp] 166 / 7e-54 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1) Potri.010G132800 [exp] 101 / 2e-28 AT3G25600 229 / 4e-78 Calcium-binding EF-hand family protein (.1) Potri.015G052600 [exp] 97 / 7e-27 AT1G18530 213 / 8e-72 EF hand calcium-binding protein family (.1) Potri.006G026700 [exp] 87 / 8e-23 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.009G021500 [exp] 87 / 8e-23 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.016G024700 [exp] 87 / 8e-23 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.001G222200 [exp] 87 / 1e-22 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3) Potri.015G032600 [exp] 85 / 3e-22 AT5G37780 284 / 3e-100 TOUCH 1, calmodulin 1 (.1.2.3) Potri.012G041000 [exp] 84 / 6e-22 AT5G37780 283 / 9e-100 TOUCH 1, calmodulin 1 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10004539 pacid=23159395 polypeptide=Lus10004539 locus=Lus10004539.g ID=Lus10004539.BGIv1.0 annot-version=v1.0 ATGATCCACAAGGCGGACACGAACAACAACGGCCTGATCAAGTTCTCGGAATTCGTGGCCCTGGTGGAACCCGACCTCGTCCAGTCGAAATGCCCCTGCA CGGAGGAGCAGCAGAGGCAGATGTTCACATTGTTCGACAAGGACGGGAATGGGTTCATCACCGCGGCCGAGCTGGCCTACTCAATGGCCAAGCTCAGCCA CGCGCTGACCGCCGCGGAGTTGACCAGCATGATTCGGGACGCGGACGGGGATGGGGACGGGTGCATTAGCTTTCAGGAGTTCGCCAAGGCCGTTACTTCC GCTTCTTTTGATAATTCTTGGTGCTGA
AA sequence Show only first row Show all	>Lus10004539 pacid=23159395 polypeptide=Lus10004539 locus=Lus10004539.g ID=Lus10004539.BGIv1.0 annot-version=v1.0 MIHKADTNNNGLIKFSEFVALVEPDLVQSKCPCTEEQQRQMFTLFDKDGNGFITAAELAYSMAKLSHALTAAELTSMIRDADGDGDGCISFQEFAKAVTS ASFDNSWC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03000			EF hand calcium-binding protei...		Lus10004539 [exp]	0	1
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	3.5	0.9975
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	4.9	0.9975
					Lus10009618 [exp]	6.0	0.9975
					Lus10005830 [exp]	6.9	0.9975
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013556 [exp]	7.7	0.9975
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039085 [exp]	8.5	0.9975
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10024077 [exp]	9.2	0.9975
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10016175 [exp]	9.3	0.9595
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10028844 [exp]	9.8	0.9973
					Lus10038463 [exp]	10.4	0.9973

Compare expression of checked genes

Lus10004539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.