Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29820 169 / 2e-51 Magnesium transporter CorA-like family protein (.1.2) AT2G42950 166 / 1e-50 Magnesium transporter CorA-like family protein (.1) AT1G29830 164 / 4e-50 Magnesium transporter CorA-like family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004605 [exp] 203 / 2e-64 AT1G29820 729 / 0.0 Magnesium transporter CorA-like family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G353000 [exp] 178 / 1e-54 AT1G29820 713 / 0.0 Magnesium transporter CorA-like family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004542 pacid=23159405 polypeptide=Lus10004542 locus=Lus10004542.g ID=Lus10004542.BGIv1.0 annot-version=v1.0 ATGAAGCACCTGCTTTACGAAGTCCCGGTGAGAGTTGCTGGAGGGCTACTGTTTGAGCTCTTGGGTCAATCAGCAGGCGATCCATTCGACGATGAGGATG ACATTCCAGTGGTACTAAGCTCTTGGCAAGCACAAAACTTCTTAGTAACTTCACTCCATGTAAAAGGTCAAGTCTCGAGGATAAATGTCTTGGGACTCAC CGAAGTCCAGGAGCTTCTCTCGAGTGGAGGTTATAATGCACCTCGAACAGTGCATGAAGTCATAGCACAACTAGCTTGCCGCTTGACTCGTTGGGATGAC AGGTAA
AA sequence Show only first row Show all	>Lus10004542 pacid=23159405 polypeptide=Lus10004542 locus=Lus10004542.g ID=Lus10004542.BGIv1.0 annot-version=v1.0 MKHLLYEVPVRVAGGLLFELLGQSAGDPFDDEDDIPVVLSSWQAQNFLVTSLHVKGQVSRINVLGLTEVQELLSSGGYNAPRTVHEVIAQLACRLTRWDD R

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29820			Magnesium transporter CorA-lik...		Lus10004542 [exp]	0	1
					Lus10021237 [exp]	1.4	0.7996
AT4G26220			S-adenosyl-L-methionine-depend...		Lus10009484 [exp]	13.2	0.7768
AT1G07745		SSN1, ATRAD51D,...	SUPPRESOR OF SNI1, homolog of ...		Lus10005437 [exp]	14.0	0.8133
AT1G67390			F-box family protein (.1)		Lus10013664 [exp]	20.7	0.7893
AT5G52880			F-box family protein (.1)		Lus10027549 [exp]	43.5	0.7767
AT3G05760	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10010928 [exp]	50.2	0.7676
AT4G10540			Subtilase family protein (.1)		Lus10031097 [exp]	54.5	0.7349
AT3G49410			Transcription factor IIIC, sub...		Lus10029671 [exp]	57.8	0.7521
AT4G25280			P-loop containing nucleoside t...		Lus10031135 [exp]	95.7	0.7083
AT4G27680			P-loop containing nucleoside t...		Lus10008835 [exp]	107.7	0.7311

Compare expression of checked genes

Lus10004542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.