Lus10004559 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G35470 250 / 2e-80 PIRL4, DREB1C plant intracellular ras group-related LRR 4 (.1)
AT2G17440 231 / 3e-73 PIRL5 plant intracellular ras group-related LRR 5 (.1)
AT3G11330 145 / 2e-40 PIRL9 plant intracellular ras group-related LRR 9 (.1)
AT5G05850 140 / 9e-39 PIRL1 plant intracellular ras group-related LRR 1 (.1)
AT3G26500 128 / 2e-34 PIRL2 plant intracellular ras group-related LRR 2 (.1)
AT1G12970 123 / 1e-32 PIRL3 plant intracellular ras group-related LRR 3 (.1)
AT4G26050 119 / 7e-32 PIRL8 plant intracellular ras group-related LRR 8 (.1)
AT4G29880 116 / 1e-30 PIRL7 plant intracellular ras group-related LRR 7 (.1)
AT2G19330 115 / 2e-30 PIRL6 plant intracellular ras group-related LRR 6 (.1)
AT3G15410 77 / 6e-16 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000900 431 / 8e-152 AT4G35470 409 / 2e-138 plant intracellular ras group-related LRR 4 (.1)
Lus10035976 254 / 9e-82 AT4G35470 652 / 0.0 plant intracellular ras group-related LRR 4 (.1)
Lus10016684 234 / 8e-71 AT1G55325 733 / 0.0 MACCHI-BOU 2, GRAND CENTRAL, RNA polymerase II transcription mediators (.1.2)
Lus10003229 127 / 7e-35 AT2G19330 408 / 4e-142 plant intracellular ras group-related LRR 6 (.1)
Lus10017948 126 / 1e-33 AT3G11330 557 / 0.0 plant intracellular ras group-related LRR 9 (.1)
Lus10013689 124 / 3e-33 AT3G11330 473 / 3e-165 plant intracellular ras group-related LRR 9 (.1)
Lus10035622 79 / 2e-18 AT2G19330 158 / 8e-48 plant intracellular ras group-related LRR 6 (.1)
Lus10021635 74 / 2e-15 AT5G07910 360 / 6e-127 Leucine-rich repeat (LRR) family protein (.1)
Lus10000681 71 / 1e-14 AT5G07910 357 / 2e-125 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G144100 300 / 6e-100 AT4G35470 448 / 6e-153 plant intracellular ras group-related LRR 4 (.1)
Potri.003G090100 300 / 8e-100 AT2G17440 416 / 2e-140 plant intracellular ras group-related LRR 5 (.1)
Potri.007G065000 267 / 1e-86 AT4G35470 693 / 0.0 plant intracellular ras group-related LRR 4 (.1)
Potri.005G098600 260 / 5e-84 AT4G35470 672 / 0.0 plant intracellular ras group-related LRR 4 (.1)
Potri.010G046500 131 / 1e-35 AT1G12970 493 / 7e-173 plant intracellular ras group-related LRR 3 (.1)
Potri.015G083800 129 / 2e-34 AT3G11330 471 / 9e-163 plant intracellular ras group-related LRR 9 (.1)
Potri.018G139700 120 / 5e-32 AT2G19330 406 / 2e-141 plant intracellular ras group-related LRR 6 (.1)
Potri.006G072700 119 / 6e-32 AT2G19330 416 / 4e-145 plant intracellular ras group-related LRR 6 (.1)
Potri.012G085600 119 / 4e-31 AT3G11330 427 / 8e-146 plant intracellular ras group-related LRR 9 (.1)
Potri.015G048800 72 / 5e-15 AT5G07910 341 / 2e-119 Leucine-rich repeat (LRR) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10004559 pacid=23159379 polypeptide=Lus10004559 locus=Lus10004559.g ID=Lus10004559.BGIv1.0 annot-version=v1.0
ATGGTGAACTTAGATTTGAGCTCAAATCACTTCACTTCCTTACCAGACACCGTAGGAGACTTGTCGAAGCTCAAGACACTGAATGCTGAAACAAATGAGC
TCGAGGAGCTTCCTTACACAATCGGAAACTGTTCCTCTCTCACAGAGCTGAGGTTAGATTTCAACAATCTGAAGGGTCTGCCTGAAGCAGTTGGGAAGCT
TGAATGCTTGGAAATTCTGACTCTGCACTACAACAGAGTCAAGAGCTTGCCAACCACAATGGGGAATCTCTTGAAACTCAAAGAGATTGATGTCAGCTTC
AACGAGCTAGAGTATATACCCGAAAGCCTGTGTTTTGCAGTACAGCTGAAGAAGATAAATGCAGGGAAGAACTTTGCAGACCTGAGAGCGTTGCCCAAAT
CCATAGGAAACCTGGAGATGCTTGAAGAGTTGGATATAAGTGATGACCAAATAAGAATGTTGCCTGATTCTTTCAGCCTCCTGTCTAAGCTTAGAGTGTT
TCTTGCTCATGAAACCCCTCTAGAAGTACCCCCGAGAGAAGTATGCAAATTGGGCGCTCAGGCTGTGGTGCAGTACATGGCTGACCTTGTCGCAAACAAG
GACTCGATATCGTCGCAGAGTTCGAAAAAGGAGAAAGGTATCTGGTTAAGGATCTGCTTGTTCTGTTTCCCGTTCTTCAGTTCTTCCAAATGA
AA sequence
>Lus10004559 pacid=23159379 polypeptide=Lus10004559 locus=Lus10004559.g ID=Lus10004559.BGIv1.0 annot-version=v1.0
MVNLDLSSNHFTSLPDTVGDLSKLKTLNAETNELEELPYTIGNCSSLTELRLDFNNLKGLPEAVGKLECLEILTLHYNRVKSLPTTMGNLLKLKEIDVSF
NELEYIPESLCFAVQLKKINAGKNFADLRALPKSIGNLEMLEELDISDDQIRMLPDSFSLLSKLRVFLAHETPLEVPPREVCKLGAQAVVQYMADLVANK
DSISSQSSKKEKGIWLRICLFCFPFFSSSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G35470 PIRL4, DREB1C plant intracellular ras group-... Lus10004559 0 1
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10022726 3.2 0.9372
AT4G35470 PIRL4, DREB1C plant intracellular ras group-... Lus10000900 4.7 0.9115
AT1G73280 SCPL3 serine carboxypeptidase-like 3... Lus10018667 4.9 0.9316
AT1G54100 ALDH7B4 aldehyde dehydrogenase 7B4 (.1... Lus10013155 5.4 0.9378
AT5G25880 ATNADP-ME3 Arabidopsis thaliana NADP-mali... Lus10043025 6.5 0.9175
AT2G21120 Protein of unknown function (D... Lus10010893 10.2 0.9087
AT5G13700 ATPAO1, APAO polyamine oxidase 1 (.1) Lus10029495 10.7 0.9274
AT1G15110 PSS1 phosphatidylserine synthase 1,... Lus10034618 11.1 0.8767
AT5G18480 PGSIP6 plant glycogenin-like starch i... Lus10000818 12.0 0.9234
AT1G16390 3-Oct, ATOCT3 organic cation/carnitine trans... Lus10000286 12.8 0.9187

Lus10004559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.