Lus10004579 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78550 65 / 9e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17010 62 / 1e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25310 59 / 1e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G21420 59 / 1e-10 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17020 59 / 1e-10 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT4G16330 54 / 4e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G25300 52 / 2e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G08640 50 / 1e-07 ATFLS1, FLS flavonol synthase 1 (.1.2)
AT1G60980 49 / 3e-07 ATGA20OX4 gibberellin 20-oxidase 4 (.1)
AT1G49390 48 / 7e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011987 134 / 2e-38 AT1G78550 284 / 1e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10011986 76 / 2e-16 AT1G17020 291 / 3e-96 senescence-related gene 1 (.1)
Lus10007405 69 / 4e-15 ND /
Lus10030149 68 / 1e-13 AT5G05340 405 / 8e-142 Peroxidase superfamily protein (.1)
Lus10011985 66 / 7e-13 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1)
Lus10042493 63 / 2e-12 AT1G17020 242 / 4e-80 senescence-related gene 1 (.1)
Lus10026173 63 / 5e-12 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1)
Lus10011980 62 / 1e-11 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10011981 62 / 1e-11 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G355200 76 / 2e-16 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1)
Potri.001G382400 72 / 2e-15 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1)
Potri.009G025900 67 / 2e-13 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.001G355100 67 / 3e-13 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
Potri.010G023600 56 / 9e-10 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G080600 54 / 6e-09 AT5G07480 453 / 9e-161 KAR-UP oxidoreductase 1 (.1)
Potri.001G381700 52 / 4e-08 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Potri.009G022800 52 / 5e-08 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1)
Potri.006G062500 50 / 9e-08 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G121700 50 / 1e-07 AT5G20400 426 / 8e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10004579 pacid=23149783 polypeptide=Lus10004579 locus=Lus10004579.g ID=Lus10004579.BGIv1.0 annot-version=v1.0
ATGGTAAGCGTTCAGGAGCTGGCCAAACGGCCACTCACCTCAATCCCACTGCAGTTTGTTCAACATCAGCTGGTCAACGGGATAGCTCCGAGTAGTTTGG
ACTCCACGGCTGCGCCAACGGTTGACATGGGACTACTTTTGTCGGCGGATCTTAGGGTTGCGAATCTCGAACTCGAAAGGCTTCACTCTTGTTGCATGGA
ATGGGGTATCTTCCAGTTAGATATACCAAAACCGTTGGTAGGGTTGATGGCAAATGCAATAAAGACGGAGAGGAAGAAGGTGGAGGAGATGATGGAGGAT
GGGATGCAATCGGTGAGGATGACTTACTATCCGCCTTGCCCTAGGTCGGATCTGGTGATGGGGATAACTTCGCACTTTGATGCATCGTGCATCACGATTC
TTAACCAGGTAATCGCCCGAATAACTGTGAAGTTATTCCGACAACACAAGTGTCGTTTGTGTCCGAAGGTCCCTCTCGCTATGCTTCTACTCGAATTCGT
CAACACGGTTTAG
AA sequence
>Lus10004579 pacid=23149783 polypeptide=Lus10004579 locus=Lus10004579.g ID=Lus10004579.BGIv1.0 annot-version=v1.0
MVSVQELAKRPLTSIPLQFVQHQLVNGIAPSSLDSTAAPTVDMGLLLSADLRVANLELERLHSCCMEWGIFQLDIPKPLVGLMANAIKTERKKVEEMMED
GMQSVRMTYYPPCPRSDLVMGITSHFDASCITILNQVIARITVKLFRQHKCRLCPKVPLAMLLLEFVNTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78550 2-oxoglutarate (2OG) and Fe(II... Lus10004579 0 1

Lus10004579 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.