Lus10004581 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25300 159 / 2e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G17020 158 / 6e-47 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT1G78550 146 / 3e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17010 145 / 6e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25310 142 / 9e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G21420 120 / 4e-32 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G38240 97 / 1e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20400 91 / 3e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20550 90 / 4e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G49390 89 / 7e-21 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011981 291 / 1e-98 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
Lus10011980 248 / 1e-81 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10011979 234 / 2e-76 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Lus10004582 201 / 3e-64 AT1G17020 231 / 2e-74 senescence-related gene 1 (.1)
Lus10015252 197 / 9e-62 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1)
Lus10026173 169 / 1e-50 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1)
Lus10022292 159 / 4e-47 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1)
Lus10011985 148 / 8e-43 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1)
Lus10030995 140 / 9e-40 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G355100 175 / 4e-53 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
Potri.001G381700 169 / 3e-51 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Potri.001G382400 164 / 6e-49 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1)
Potri.009G025900 149 / 3e-43 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.001G355200 129 / 1e-35 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1)
Potri.010G023600 115 / 2e-30 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.009G022800 114 / 5e-30 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1)
Potri.010G023550 105 / 1e-28 AT3G21420 210 / 6e-68 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G200900 103 / 6e-26 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101100 100 / 5e-25 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10004581 pacid=23149780 polypeptide=Lus10004581 locus=Lus10004581.g ID=Lus10004581.BGIv1.0 annot-version=v1.0
ATGCCTCCCAGTTCCTTGCGTTCAAGAGCTCGCCAAAGATCCTCTGCTCGCCGCCTCCGTCAACCACATGATACTATCATCAATCCCGCCGTCCAAGTTC
CCGTTATTGATTTCCGCAAAATAGCGTGTCCGCCGTCGAGTGACGTCTACGACGACGAGCTTGGTAGGCTCTACGACGCTTGTAAACATTGGGGCTTCTT
CCAGGTGGTTAATCATGGGGTGAGCAATTTATTAGAGGAGAGAATGAAGAAGGAGGTTCAAGAATGGTTCAACATTCCAATGGAAGAGAAGAAGAAGTTC
TGGCAAAGATCTGGTGATTTGAAAGGTTTTGGGCAAGTCTTCGTGGTTTCTGAAGAACAAAAGTTAGATTGGGGAGATATGTTCTTCATCACTACACATC
TCAGGACACCTTACCTCTTTCCCTTGTTGCCTCTTTCACTAAGGAGGGATACGTTGGAATATTCAGCAGCACTAAATAGTCTGGCTATGAAAATCCTGAA
CCTGATGGCCAAAGCTCTAGGGATGGACCGAACTGACATGAACGTATTGTTTGGAGAAGAAGCGTGGCGAACAATTCCGAACGAACTATTATCAACGATG
CCCGCAGCCGGAGCTGGTGATGGGTCTAAACTCTCACTCCGACACTGCCGGACTCACAATACTGTTACGAAGTGA
AA sequence
>Lus10004581 pacid=23149780 polypeptide=Lus10004581 locus=Lus10004581.g ID=Lus10004581.BGIv1.0 annot-version=v1.0
MPPSSLRSRARQRSSARRLRQPHDTIINPAVQVPVIDFRKIACPPSSDVYDDELGRLYDACKHWGFFQVVNHGVSNLLEERMKKEVQEWFNIPMEEKKKF
WQRSGDLKGFGQVFVVSEEQKLDWGDMFFITTHLRTPYLFPLLPLSLRRDTLEYSAALNSLAMKILNLMAKALGMDRTDMNVLFGEEAWRTIPNELLSTM
PAAGAGDGSKLSLRHCRTHNTVTK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25300 2-oxoglutarate (2OG) and Fe(II... Lus10004581 0 1
AT4G26140 BGAL12 beta-galactosidase 12 (.1.2) Lus10028848 1.4 0.9771
AT4G16970 Protein kinase superfamily pro... Lus10040153 1.4 0.9719
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10021725 2.2 0.9506
Lus10003411 3.3 0.9317
AT5G03810 GDSL-like Lipase/Acylhydrolase... Lus10040791 3.5 0.9475
AT1G79450 ALIS5 ALA-interacting subunit 5 (.1.... Lus10033283 3.9 0.9565
Lus10016958 4.6 0.9406
AT5G22090 Protein of unknown function (D... Lus10013353 4.9 0.9369
AT3G14610 CYP72A7 "cytochrome P450, family 72, s... Lus10025006 6.0 0.9337
AT4G10960 UGE5 UDP-D-glucose/UDP-D-galactose ... Lus10001822 6.0 0.9170

Lus10004581 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.