Lus10004589 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G18100 228 / 1e-78 Ribosomal protein L32e (.1)
AT5G46430 226 / 1e-77 Ribosomal protein L32e (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012195 244 / 6e-85 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10007541 244 / 6e-85 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10011970 242 / 3e-84 AT4G18100 246 / 1e-85 Ribosomal protein L32e (.1)
Lus10020410 241 / 1e-83 AT4G18100 242 / 3e-84 Ribosomal protein L32e (.1)
Lus10031699 239 / 5e-83 AT4G18100 240 / 2e-83 Ribosomal protein L32e (.1)
Lus10009591 240 / 4e-82 AT4G18100 243 / 4e-83 Ribosomal protein L32e (.1)
Lus10031120 241 / 1e-79 AT3G22660 289 / 9e-96 rRNA processing protein-related (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G353900 231 / 9e-80 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.014G191000 231 / 9e-80 AT4G18100 227 / 4e-78 Ribosomal protein L32e (.1)
Potri.002G249000 228 / 1e-78 AT4G18100 226 / 5e-78 Ribosomal protein L32e (.1)
Potri.011G078200 226 / 8e-78 AT4G18100 225 / 2e-77 Ribosomal protein L32e (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01655 Ribosomal_L32e Ribosomal protein L32
Representative CDS sequence
>Lus10004589 pacid=23149754 polypeptide=Lus10004589 locus=Lus10004589.g ID=Lus10004589.BGIv1.0 annot-version=v1.0
ATGGCCGTGCCACTGTTGACGAAGAAGATTGTGAAGAAGAGGGTCAAACAGTTCAAGAGGCCCCAAGCCGATCGGAAGATATGCGTCAAGGAAAACTGGA
GGAGGCCAAAGGGTATCGACTCCAGGGTCAGGAGAAAGTTCAAGGGTGTAACGTTGATGCCCAACATCGGTTACGGCTCAGACAAGAAAACCCGACACTA
TCTTCCCAATGGCTTCAAGAAGTTCGTAGTCCACAACACTAAGGAGCTCGAGGTTCTGATGATGCACAACAGGACCTACTGTGCCGAGATCGCCCATGAC
GTCTCGACCAGAAAGAGGAAGGACATCGTTGAGCGTGCTGCGCAGTTGGACATTGTCGTCACCAACAAGCTTGCTAGGCTCAGGAGCCAGGAAGACGAGT
AG
AA sequence
>Lus10004589 pacid=23149754 polypeptide=Lus10004589 locus=Lus10004589.g ID=Lus10004589.BGIv1.0 annot-version=v1.0
MAVPLLTKKIVKKRVKQFKRPQADRKICVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNTKELEVLMMHNRTYCAEIAHD
VSTRKRKDIVERAAQLDIVVTNKLARLRSQEDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G18100 Ribosomal protein L32e (.1) Lus10004589 0 1
AT3G11510 Ribosomal protein S11 family p... Lus10014220 1.4 0.9008
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10027194 1.7 0.8800
AT3G13580 Ribosomal protein L30/L7 famil... Lus10016970 2.8 0.9013
AT2G19385 zinc ion binding (.1) Lus10027626 3.5 0.8752
AT3G55510 RBL REBELOTE, Noc2p family (.1) Lus10041417 4.4 0.8351
AT5G63890 HISN8, ATHDH HISTIDINE BIOSYNTHESIS 8, hist... Lus10031985 4.9 0.8474
AT1G36240 Ribosomal protein L7Ae/L30e/S1... Lus10016431 6.0 0.8672
AT2G19740 Ribosomal protein L31e family ... Lus10018032 6.7 0.8706
AT5G02960 Ribosomal protein S12/S23 fami... Lus10026479 8.9 0.8664
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10035401 9.5 0.8385

Lus10004589 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.