Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011967 [exp] 76 / 3e-17 AT4G18130 1444 / 0.0 phytochrome E (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004594 pacid=23149778 polypeptide=Lus10004594 locus=Lus10004594.g ID=Lus10004594.BGIv1.0 annot-version=v1.0 ATGGGAGTCGAAGAGATCCAGGATAGAACCGCCGCCGCCGCGGTCTCGTCGTCGTCGGCGGCGAGCAACATGAGGACGATCAACGACAACACGAAAGGTA AAGCCACCATTGCCCAGTTCAACGCCGACGCAGGCCTGTTAGCGAAGTTCGAGTCGAACAAGTCCTTTAACTACTCAAGATCGTTTCTTTCCAGCCGGCG GAGCCAGTGCCGGAGGAGCAGGTCGCCATTTACCTCTCCAGAATCCAGCGCGGCGGCTTCATCCAGCCCTTTGGGTGTCTTCTCGCATTTGAAGAGATAA
AA sequence Show only first row Show all	>Lus10004594 pacid=23149778 polypeptide=Lus10004594 locus=Lus10004594.g ID=Lus10004594.BGIv1.0 annot-version=v1.0 MGVEEIQDRTAAAAVSSSSAASNMRTINDNTKGKATIAQFNADAGLLAKFESNKSFNYSRSFLSSRRSQCRRSRSPFTSPESSAAASSSPLGVFSHLKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004594 [exp]	0	1
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Lus10005879 [exp]	3.7	0.8514
AT5G19620		TOC75-V, EMB213...	translocon at the outer envelo...		Lus10031272 [exp]	7.6	0.8444
AT5G06900		CYP93D1	"cytochrome P450, family 93, s...		Lus10005878 [exp]	8.9	0.8064
AT3G61780		EMB1703	embryo defective 1703 (.1)		Lus10004004 [exp]	9.0	0.8226
AT1G69320		CLE10	CLAVATA3/ESR-RELATED 10 (.1)		Lus10036960 [exp]	9.5	0.7897
AT3G11170		AtFAD7, FADD, F...	FATTY ACID DESATURASE D, fatty...		Lus10018245 [exp]	10.1	0.8052
AT1G01420		UGT72B3	UDP-glucosyl transferase 72B3 ...		Lus10001905 [exp]	16.7	0.7977
AT3G62060			Pectinacetylesterase family pr...		Lus10009966 [exp]	17.3	0.7866
AT3G54660		ATGR2, EMB2360,...	glutathione reductase (.1)		Lus10024857 [exp]	17.3	0.8215
AT5G62620			Galactosyltransferase family p...		Lus10036685 [exp]	17.5	0.8051

Compare expression of checked genes

Lus10004594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.