Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55140 161 / 8e-53 ribosomal protein L30 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031912 [exp] 213 / 1e-73 AT5G55140 161 / 7e-53 ribosomal protein L30 family protein (.1) Lus10011966 [exp] 213 / 2e-73 AT5G55140 160 / 1e-52 ribosomal protein L30 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G225600 [exp] 177 / 3e-59 AT5G55140 154 / 4e-50 ribosomal protein L30 family protein (.1) Potri.014G157400 [exp] 170 / 1e-56 AT5G55140 151 / 5e-49 ribosomal protein L30 family protein (.1) Potri.010G076275 [exp] 79 / 2e-20 AT5G55140 68 / 2e-16 ribosomal protein L30 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00327 [flax] [poplar] Ribosomal_L30 Ribosomal protein L30p/L7e
Representative CDS sequence Show only first row Show all	>Lus10004595 pacid=23149772 polypeptide=Lus10004595 locus=Lus10004595.g ID=Lus10004595.BGIv1.0 annot-version=v1.0 ATGAACGGTTTCAAGGCTTTCAAAGCCCAAGTGCCAATAGCTTGGAGTCCTCGTCTATACATAACTCTGGTCAGAGGGATTCCCGGAACCAGGAGACTCC ACAGGCGCACCCTCGAGGCATTGTGTCTCACCAAGTGCAACCGAACAGTAACCCGTGAAAATTGTTCTTCCATTAGAGGAATGCTTCAACAGGTGAAGAG ATTAGTCGTGATCGAGACCGAAGAGATGTACAATGCTCGCAAGGAGAACGACGCAAAGCACAAGGCTGTTCGTCCTCCAGTCGTTATAGGCCACTCTCCA GTCGCTGCGAGGAGCTCTGCATAG
AA sequence Show only first row Show all	>Lus10004595 pacid=23149772 polypeptide=Lus10004595 locus=Lus10004595.g ID=Lus10004595.BGIv1.0 annot-version=v1.0 MNGFKAFKAQVPIAWSPRLYITLVRGIPGTRRLHRRTLEALCLTKCNRTVTRENCSSIRGMLQQVKRLVVIETEEMYNARKENDAKHKAVRPPVVIGHSP VAARSSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55140			ribosomal protein L30 family p...		Lus10004595 [exp]	0	1
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Lus10032591 [exp]	3.2	0.9578
AT4G39520			GTP-binding protein-related (....		Lus10005800 [exp]	4.0	0.9465
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10010429 [exp]	4.5	0.9588
AT1G27090			glycine-rich protein (.1)		Lus10037224 [exp]	6.0	0.9514
AT4G39200			Ribosomal protein S25 family p...		Lus10023552 [exp]	11.4	0.9387
AT5G42820	C3HZnF	ATU2AF35B	Zinc finger C-x8-C-x5-C-x3-H t...		Lus10003375 [exp]	12.0	0.9340
AT3G11510			Ribosomal protein S11 family p...		Lus10022693 [exp]	12.1	0.9430
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10004942 [exp]	12.5	0.9355
AT5G35530			Ribosomal protein S3 family pr...		Lus10030502 [exp]	13.8	0.9459
AT1G53850		PAE1, ATPAE1	ARABIDOPSIS 20S PROTEASOME ALP...		Lus10037454 [exp]	13.9	0.9362

Compare expression of checked genes

Lus10004595 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.