Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62310 107 / 2e-27 transcription factor jumonji (jmjC) domain-containing protein (.1) AT3G07610 101 / 3e-25 IBM1 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) AT1G11950 100 / 8e-25 Transcription factor jumonji (jmjC) domain-containing protein (.1) AT4G00990 92 / 7e-22 Transcription factor jumonji (jmjC) domain-containing protein (.1) AT1G09060 67 / 3e-13 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3) AT4G21430 59 / 2e-10 B160 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027890 [exp] 133 / 4e-36 AT3G07610 578 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10015260 [exp] 131 / 1e-35 AT3G07610 627 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10002391 [exp] 131 / 2e-35 AT3G07610 607 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10002052 [exp] 110 / 8e-31 AT1G62310 199 / 5e-60 transcription factor jumonji (jmjC) domain-containing protein (.1) Lus10020033 [exp] 107 / 2e-27 AT1G62310 843 / 0.0 transcription factor jumonji (jmjC) domain-containing protein (.1) Lus10004549 [exp] 90 / 3e-21 AT3G07610 173 / 8e-49 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Lus10020084 [exp] 72 / 1e-14 AT4G21430 529 / 2e-172 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Lus10006741 [exp] 69 / 1e-13 AT4G21430 440 / 1e-141 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Lus10017092 [exp] 66 / 8e-13 AT1G09060 962 / 0.0 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G082901 [exp] 127 / 3e-34 AT3G07610 702 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Potri.005G091200 [exp] 125 / 1e-33 AT3G07610 732 / 0.0 increase in bonsai methylation 1, Transcription factor jumonji (jmjC) domain-containing protein (.1), Transcription factor jumonji (jmjC) domain-containing protein (.2), Transcription factor jumonji (jmjC) domain-containing protein (.3) Potri.004G006200 [exp] 114 / 8e-30 AT1G11950 870 / 0.0 Transcription factor jumonji (jmjC) domain-containing protein (.1) Potri.011G009700 [exp] 106 / 8e-27 AT1G11950 863 / 0.0 Transcription factor jumonji (jmjC) domain-containing protein (.1) Potri.015G012800 [exp] 98 / 6e-24 AT4G00990 508 / 4e-157 Transcription factor jumonji (jmjC) domain-containing protein (.1) Potri.004G032700 [exp] 81 / 7e-18 AT4G21430 522 / 1e-169 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Potri.011G041400 [exp] 76 / 3e-16 AT4G21430 465 / 2e-148 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1) Potri.005G027000 [exp] 55 / 4e-09 AT1G09060 759 / 0.0 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3) Potri.013G019000 [exp] 55 / 4e-09 AT1G09060 996 / 0.0 Zinc finger, RING-type;Transcription factor jumonji/aspartyl beta-hydroxylase (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004603 pacid=23149779 polypeptide=Lus10004603 locus=Lus10004603.g ID=Lus10004603.BGIv1.0 annot-version=v1.0 ATGGAGGGAATTGACGTAGTGGAGGGAGGTGCTCTATGGGACAACTTCCGCCGAGAAGATGTTCCCAAGCTGGAGGAATATCTTCACAAGCACTTCAAAG AGTTCAGGCACATCCATTGCTCTCCTCTGCAACAGGTATCGAACCGTGGACATTCGTCCAGAAACTTGGTGATGATGTCTTTATCCCAAGCTGGCTGTCC TCATCAAGTCCGAAATTTGAAGGCGAATCATTCGTGCATCAATGTAGCATCACACTTCGTCTCGCCCGAAAACGTCGGAGAGTGCATTCGTCTGACAGAG GAGATTCAGTCTTCTCCCGATGAACCATCGTTCAAAGGAAGACTCATTACAGCGAAGGTGAGAGTCCCCCCCTTCTGTACAGAGCATTTCTTCGAGTTCG GTATCGTATCAGGTTCAGAAGATGTGTATCTACCCGGTGAAATGGGCATTGGATGTCTTTACTCGCCGATAAGGGAAGATCCGGAGATGGCAACGATGAA GGAAATGGATCGAAGGGTAACAAGAGGAATGTGA
AA sequence Show only first row Show all	>Lus10004603 pacid=23149779 polypeptide=Lus10004603 locus=Lus10004603.g ID=Lus10004603.BGIv1.0 annot-version=v1.0 MEGIDVVEGGALWDNFRREDVPKLEEYLHKHFKEFRHIHCSPLQQVSNRGHSSRNLVMMSLSQAGCPHQVRNLKANHSCINVASHFVSPENVGECIRLTE EIQSSPDEPSFKGRLITAKVRVPPFCTEHFFEFGIVSGSEDVYLPGEMGIGCLYSPIREDPEMATMKEMDRRVTRGM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62310			transcription factor jumonji (...		Lus10004603 [exp]	0	1
					Lus10011218 [exp]	2.4	0.9313
AT4G13830		J20	DNAJ-like 20 (.1.2)		Lus10000689 [exp]	3.6	0.7691
AT5G12060			Plant self-incompatibility pro...		Lus10023085 [exp]	4.0	0.9101
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10006693 [exp]	4.9	0.9101
AT5G18460			Protein of Unknown Function (D...		Lus10006861 [exp]	5.7	0.9101
AT2G17030			F-box family protein with a do...		Lus10022619 [exp]	6.3	0.9018
AT2G39730		RCA	rubisco activase (.1.2.3)		Lus10035616 [exp]	6.9	0.8989
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10001037 [exp]	7.9	0.8545
AT5G03620			Subtilisin-like serine endopep...		Lus10003254 [exp]	8.0	0.8486
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Lus10026929 [exp]	8.5	0.6538

Compare expression of checked genes

Lus10004603 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.