Lus10004617 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23290 258 / 3e-90 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G70600 255 / 6e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G12960 130 / 4e-40 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026698 291 / 4e-103 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10016336 290 / 1e-102 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10036855 285 / 2e-100 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10006207 285 / 2e-100 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10039528 278 / 9e-98 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10024161 276 / 5e-97 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G202300 271 / 3e-95 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.008G187000 269 / 3e-94 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.016G069000 268 / 4e-94 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.010G045800 268 / 6e-94 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10004617 pacid=23176358 polypeptide=Lus10004617 locus=Lus10004617.g ID=Lus10004617.BGIv1.0 annot-version=v1.0
ATGGCGACGGGATTGAAGAAGAACCGCAAGAAGAGGGGCCACGTCAGCGCCGGACACGGACGTGTCGGAAAGCACCGCAAGCATCCCGGAGGTAGAGGTA
ACGCCGGAGGCATGCACCACCACAGGATCCTATTCGACAAGTACCATCCAGGTTACTTCGGGAAAGTCGGGATGAGGTACTTCCACAAGCTGAAGAACAG
GTTCTTCTGCCCGATCGTTAACATCGACAAGCTCTGGTCGATGGTGCCGCAGGAGGTGAAGGACAAAGCCACCAAAGACGGAGGCGCCGCTCCAATGATC
GACGTCACTCAGTTTGGGTACTTCAAGGTTTTGGGCAAAGGTGTGTTGCCGGACAATCAGCCGATTGTGGTGAAGGCCAAGCTCGTGTCGAAGACCGCTG
AGAGGAAGATTAAGGAAGCTGGTGGCGCAGTTGTGCTCACTGCTTGA
AA sequence
>Lus10004617 pacid=23176358 polypeptide=Lus10004617 locus=Lus10004617.g ID=Lus10004617.BGIv1.0 annot-version=v1.0
MATGLKKNRKKRGHVSAGHGRVGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLKNRFFCPIVNIDKLWSMVPQEVKDKATKDGGAAPMI
DVTQFGYFKVLGKGVLPDNQPIVVKAKLVSKTAERKIKEAGGAVVLTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10004617 0 1
AT3G11400 ATEIF3G1, EIF3G... eukaryotic translation initiat... Lus10030482 2.0 0.9629
AT3G57490 Ribosomal protein S5 family pr... Lus10027358 2.2 0.9764
AT2G04390 Ribosomal S17 family protein (... Lus10004208 2.4 0.9705
AT4G35490 MRPL11 mitochondrial ribosomal protei... Lus10031045 2.4 0.9636
AT4G15770 RNA binding (.1) Lus10037509 4.6 0.9541
AT2G47990 SWA1, EDA13, ED... SLOW WALKER1, EMBRYO SAC DEVEL... Lus10015340 4.6 0.9369
AT3G44590 60S acidic ribosomal protein f... Lus10020575 5.5 0.9458
AT5G14040 PHT3;1 phosphate transporter 3;1 (.1) Lus10012574 7.1 0.9177
AT3G49910 Translation protein SH3-like f... Lus10018139 7.4 0.9595
AT5G40660 ATP12 protein-related (.1) Lus10009910 8.5 0.9256

Lus10004617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.