Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61412 37 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026680 [exp] 42 / 6e-06 AT3G22590 63 / 1e-11 PLANT HOMOLOGOUS TO PARAFIBROMIN (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G129466 [exp] 53 / 2e-10 ND / Potri.019G129700 [exp] 50 / 6e-10 ND / Potri.007G146700 [exp] 50 / 8e-10 ND / Potri.010G244000 [exp] 49 / 2e-09 ND / Potri.019G129820 [exp] 48 / 3e-09 ND / Potri.019G129600 [exp] 49 / 7e-09 ND / Potri.019G129200 [exp] 49 / 7e-09 ND / Potri.019G129532 [exp] 47 / 8e-09 ND / Potri.002G247200 [exp] 47 / 1e-08 ND / Potri.019G129860 [exp] 49 / 2e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004635 pacid=23176407 polypeptide=Lus10004635 locus=Lus10004635.g ID=Lus10004635.BGIv1.0 annot-version=v1.0 ATGTCTGGAAGCGATCAGGATTCGACGATCACGAAACTGGTGAGCGCAATCGCTGGAGCTGCAGCCGTGGCTTACGCCATTGCTTCGCTCTTCTCCGGCA GCGGAGGAGGAGGGAAGACCATGAAGGCTCCCGGAAAGGGTAATAATGAGCGTATCTCCAGGACCGGTTTCGAAAGTAACCCTTCGGGTTACTTCCGCGA TCTTCGCAAGAAGTAA
AA sequence Show only first row Show all	>Lus10004635 pacid=23176407 polypeptide=Lus10004635 locus=Lus10004635.g ID=Lus10004635.BGIv1.0 annot-version=v1.0 MSGSDQDSTITKLVSAIAGAAAVAYAIASLFSGSGGGGKTMKAPGKGNNERISRTGFESNPSGYFRDLRKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004635 [exp]	0	1
					Lus10009381 [exp]	1.0	0.9157
AT5G37150			P-loop containing nucleoside t...		Lus10035775 [exp]	1.4	0.8444
					Lus10008678 [exp]	1.7	0.8171
AT2G38430			unknown protein		Lus10030356 [exp]	4.5	0.7471
AT5G45840			Leucine-rich repeat protein ki...		Lus10007281 [exp]	6.0	0.8053
AT3G14250			RING/U-box superfamily protein...		Lus10026104 [exp]	6.0	0.7011
AT3G14250			RING/U-box superfamily protein...		Lus10000412 [exp]	6.9	0.7256
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Lus10006141 [exp]	7.7	0.7867
AT1G65810			P-loop containing nucleoside t...		Lus10035774 [exp]	8.8	0.7865
					Lus10040835 [exp]	10.2	0.7706

Compare expression of checked genes

Lus10004635 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.