Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02310 245 / 4e-82 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) AT2G03710 242 / 8e-81 MADS AGL3, SEP4 SEPALLATA 4, AGAMOUS-like 3, K-box region and MADS-box transcription factor family protein (.1.2.3) AT5G15800 241 / 1e-80 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) AT1G24260 232 / 7e-77 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) AT2G45650 184 / 6e-58 MADS AGL6 AGAMOUS-like 6 (.1) AT5G60910 177 / 2e-55 MADS FUL, AGL8 FRUITFULL, AGAMOUS-like 8 (.1.2) AT1G26310 177 / 3e-55 MADS CAL1, AGL10, CAL CAULIFLOWER, AGAMOUS-like 10, K-box region and MADS-box transcription factor family protein (.1) AT1G69120 176 / 1e-54 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1) AT3G58780 157 / 1e-47 MADS AGL1, SHP1 SHATTERPROOF 1, AGAMOUS-like 1, K-box region and MADS-box transcription factor family protein (.1.2.3) AT3G61120 156 / 4e-47 MADS AGL13 AGAMOUS-like 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026678 [exp] 412 / 2e-148 AT5G15800 225 / 3e-74 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10034663 [exp] 250 / 9e-84 AT5G15800 267 / 4e-90 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10005080 [exp] 242 / 1e-80 AT3G02310 372 / 1e-131 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10034371 [exp] 236 / 2e-78 AT3G02310 364 / 3e-128 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Lus10003125 [exp] 217 / 7e-72 AT1G24260 290 / 9e-101 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10003124 [exp] 218 / 7e-71 AT1G24260 355 / 6e-125 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10037040 [exp] 210 / 4e-68 AT1G24260 350 / 7e-123 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10015765 [exp] 209 / 1e-67 AT1G24260 347 / 5e-122 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10004637 [exp] 175 / 4e-55 AT1G69120 318 / 2e-111 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G098400 [exp] 272 / 6e-93 AT5G15800 275 / 2e-93 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Potri.004G115500 [exp] 234 / 1e-77 AT3G02310 357 / 4e-126 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.017G099700 [exp] 233 / 2e-77 AT3G02310 372 / 8e-132 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1) Potri.001G058400 [exp] 228 / 3e-75 AT1G24260 362 / 8e-128 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.003G169600 [exp] 226 / 9e-75 AT1G24260 359 / 7e-127 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.014G074100 [exp] 199 / 4e-64 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1) Potri.015G134800 [exp] 185 / 4e-58 AT2G45650 209 / 2e-67 AGAMOUS-like 6 (.1) Potri.012G062300 [exp] 182 / 3e-57 AT5G60910 288 / 5e-99 FRUITFULL, AGAMOUS-like 8 (.1.2) Potri.012G132600 [exp] 174 / 2e-54 AT2G45650 182 / 3e-57 AGAMOUS-like 6 (.1) Potri.008G098500 [exp] 174 / 3e-54 AT1G69120 336 / 9e-118 APETALA1, AGAMOUS-like 7, K-box region and MADS-box transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01486 [flax] [poplar] K-box K-box region PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10004638 pacid=23176385 polypeptide=Lus10004638 locus=Lus10004638.g ID=Lus10004638.BGIv1.0 annot-version=v1.0 ATGGGGAGAGGGAGAGTGGAGCTGAAGAGGATAGAGAACAAGATCAACAGGCAAGTCACATTTGCAAAGAGGAGGAATGGTCTACTCAAAAAGGCTTATG AGCTCTCTGTGCTTTGTGATGCTGAGGTTGCTCTCATCCTCTTCTCCAGCCGTGGCAAGCTCTACGAGTTCTGCAGCTCCTCCAGTATGGTGAAGACCAT AGAGAAGTATCAAAGGTACACCTATGGACAACTAGAACCAAGCCAAACTTCTAGGGAGACCCAGAATAATTACCAGGATTATTTGAAGCTAAAAGAGAAG GTGGAGGACCTTAAACGCTCTCAAAGGCATCTTCTTGGAGAGGAGTTGGGGAATTTGGGGGCTAAAGAGTTGGACCAAATGGAGAATCAGCTTGATGGGT CTCTCAAGCAAATAAGACTTGTCAAGACTCAGGTGATTGTAGATCAACTCTCAAACCTTAAACAAAAGGGAGATTTGCTTGAGGAAACAAACAAGGCCTT ACTAATCAAGCTGGAGGAGACAAATGCAGGCATGAGACATTCCACATGGGAAGTTGGGGAAAACTCAGCTGATCAGCAGCCACATCAGCAGATAATAGCA ACAGAGAAACCTTCTTCTTCTTCAGCTGTTGCAGAAACTGTGATGATCAATGGCGGATCGGGAGCTCTCATCAGCAGGCCTCCATGGATGCTTTAG
AA sequence Show only first row Show all	>Lus10004638 pacid=23176385 polypeptide=Lus10004638 locus=Lus10004638.g ID=Lus10004638.BGIv1.0 annot-version=v1.0 MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALILFSSRGKLYEFCSSSSMVKTIEKYQRYTYGQLEPSQTSRETQNNYQDYLKLKEK VEDLKRSQRHLLGEELGNLGAKELDQMENQLDGSLKQIRLVKTQVIVDQLSNLKQKGDLLEETNKALLIKLEETNAGMRHSTWEVGENSADQQPHQQIIA TEKPSSSSAVAETVMINGGSGALISRPPWML

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02310	MADS	AGL4, SEP2	SEPALLATA 2, AGAMOUS-like 4, K...		Lus10004638 [exp]	0	1
AT2G41480			Peroxidase superfamily protein...		Lus10009990 [exp]	1.0	0.8662
AT1G06260			Cysteine proteinases superfami...		Lus10041788 [exp]	10.4	0.7946
					Lus10032968 [exp]	13.9	0.8221
					Lus10032814 [exp]	16.7	0.8219
					Lus10002313 [exp]	19.3	0.8219
					Lus10026042 [exp]	21.6	0.8219
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	23.6	0.8219
					Lus10012669 [exp]	25.5	0.8219
					Lus10013504 [exp]	27.3	0.8219
					Lus10008789 [exp]	28.9	0.8219

Compare expression of checked genes

Lus10004638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.