Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26355 103 / 8e-30 SP1L1 SPIRAL1-like1 (.1) AT1G69230 97 / 3e-27 SP1L2 SPIRAL1-like2 (.1.2) AT2G03680 85 / 2e-22 SKU6, SPR1 spiral1 (.1.2) AT3G02180 78 / 7e-20 SP1L3 SPIRAL1-like3 (.1.2.3) AT5G15600 74 / 2e-18 SP1L4 SPIRAL1-like4 (.1) AT4G23496 65 / 8e-15 SP1L5 SPIRAL1-like5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026672 [exp] 118 / 1e-35 AT1G26355 149 / 4e-48 SPIRAL1-like1 (.1) Lus10026670 [exp] 115 / 1e-34 AT1G26355 150 / 1e-48 SPIRAL1-like1 (.1) Lus10037069 [exp] 110 / 2e-32 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1) Lus10036916 [exp] 109 / 4e-32 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10000046 [exp] 109 / 4e-32 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10034675 [exp] 84 / 3e-22 AT1G26355 127 / 5e-39 SPIRAL1-like1 (.1) Lus10032988 [exp] 72 / 3e-17 AT1G69230 99 / 8e-28 SPIRAL1-like2 (.1.2) Lus10024667 [exp] 63 / 2e-14 AT4G23496 74 / 2e-19 SPIRAL1-like5 (.1) Lus10032297 [exp] 64 / 3e-14 AT1G69230 98 / 7e-28 SPIRAL1-like2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G097000 [exp] 98 / 1e-27 AT1G26355 127 / 2e-39 SPIRAL1-like1 (.1) Potri.010G157600 [exp] 96 / 1e-26 AT1G26355 120 / 1e-36 SPIRAL1-like1 (.1) Potri.015G059100 [exp] 84 / 5e-22 AT1G26355 98 / 1e-27 SPIRAL1-like1 (.1) Potri.017G095200 [exp] 83 / 5e-22 AT1G69230 94 / 2e-26 SPIRAL1-like2 (.1.2) Potri.001G100100 [exp] 65 / 9e-15 AT4G23496 81 / 2e-21 SPIRAL1-like5 (.1) Potri.003G131600 [exp] 64 / 2e-14 AT4G23496 81 / 4e-21 SPIRAL1-like5 (.1) Potri.T124504 [exp] 54 / 2e-09 AT1G19270 182 / 3e-53 DA1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004642 pacid=23176393 polypeptide=Lus10004642 locus=Lus10004642.g ID=Lus10004642.BGIv1.0 annot-version=v1.0 ATGGGTCGCGGAGTTAGCAGCGGTGGAGGGCAGAGTTCGTTGGGATATCTATTCGGTAGCGGTGAAGCTCCCACCAAACCTGCTGCGAAAGCTGCCCCTA GTGAACCCGAGACTGTAAATGTTAAGCCAGTAGCAGCTCCCAAACCGGCTCCTCCCCCGGTCGACATCACTAAGCAGATTCCTGCTGGCATCAACAGTAC TTCGTCGAATAACTACATGCGCTCCAGCGGTCAGAATGCAGGCAACTTCCTCACAGATCGACCTTCGACGAAGGTTCATGCTGCACCTGGTGGAGGGTCT TCTCTGGATTACCTGTTTGGTAATGGTGGTAGCAACTAG
AA sequence Show only first row Show all	>Lus10004642 pacid=23176393 polypeptide=Lus10004642 locus=Lus10004642.g ID=Lus10004642.BGIv1.0 annot-version=v1.0 MGRGVSSGGGQSSLGYLFGSGEAPTKPAAKAAPSEPETVNVKPVAAPKPAPPPVDITKQIPAGINSTSSNNYMRSSGQNAGNFLTDRPSTKVHAAPGGGS SLDYLFGNGGSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10004642 [exp]	0	1
AT4G13840			HXXXD-type acyl-transferase fa...		Lus10016638 [exp]	2.4	0.8527
AT4G13950		RALFL31	ralf-like 31 (.1)		Lus10022561 [exp]	2.6	0.8645
					Lus10004134 [exp]	5.3	0.7859
AT2G13690			PRLI-interacting factor, putat...		Lus10020892 [exp]	6.9	0.8127
AT3G14920			Peptide-N4-(N-acetyl-beta-gluc...		Lus10017926 [exp]	12.9	0.8562
AT1G11270			F-box and associated interacti...		Lus10013934 [exp]	14.0	0.7868
AT2G34585			unknown protein		Lus10038503 [exp]	17.5	0.7691
AT4G23740			Leucine-rich repeat protein ki...		Lus10033936 [exp]	17.9	0.8377
AT2G41130	bHLH	bHLH106	basic helix-loop-helix (bHLH) ...		Lus10018020 [exp]	22.4	0.7460
AT3G07480			2Fe-2S ferredoxin-like superfa...		Lus10009565 [exp]	23.8	0.8036

Compare expression of checked genes

Lus10004642 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.