Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G03640 183 / 1e-52 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain AT3G25150 166 / 6e-46 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G69250 146 / 8e-39 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G60980 127 / 7e-32 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G13730 110 / 3e-26 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT5G48650 99 / 6e-22 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT3G07250 71 / 2e-12 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1) AT5G43960 65 / 3e-11 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G55540 61 / 5e-10 nuclear transport factor 2 (NTF2) family protein (.1) AT1G27970 50 / 3e-07 NTF2B nuclear transport factor 2B (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026668 [exp] 600 / 0 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10036918 [exp] 363 / 3e-121 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10037066 [exp] 356 / 2e-118 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Lus10022765 [exp] 129 / 2e-32 AT3G25150 408 / 1e-138 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10003144 [exp] 125 / 8e-31 AT3G25150 385 / 2e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10025906 [exp] 125 / 1e-30 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10023722 [exp] 78 / 3e-15 AT5G43960 266 / 2e-83 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10022873 [exp] 78 / 4e-15 AT5G43960 377 / 1e-127 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10014469 [exp] 75 / 3e-14 AT5G43960 156 / 4e-43 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G096700 [exp] 267 / 3e-84 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.010G157800 [exp] 158 / 6e-43 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.017G094600 [exp] 149 / 1e-39 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 141 / 8e-37 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G246600 [exp] 130 / 2e-32 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 86 / 8e-18 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G257000 [exp] 81 / 5e-16 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.014G192900 [exp] 74 / 4e-14 AT5G43960 392 / 3e-133 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.011G025500 [exp] 56 / 4e-09 AT1G11570 171 / 5e-56 NTF2-like (.1.2) Potri.003G170800 [exp] 54 / 8e-09 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0051 [flax] [poplar] NTF2 PF02136 [flax] [poplar] NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence Show only first row Show all	>Lus10004644 pacid=23176369 polypeptide=Lus10004644 locus=Lus10004644.g ID=Lus10004644.BGIv1.0 annot-version=v1.0 ATGACGACCGAAGATTCCGTTCCCAATGCACAACTGGTGGGGAACGCCTTTGTGGAGCAGTACTACAACATGCTCTCGAGAGCACCGGAGAATGTTCACA AGTTTTATCAGGACTCGAGTGTCATGAGCAGGCCTAGTTCGGATGGTTCAATGTCCTCTGTCTCCACGATGCAGGGGATTAACGAGCTGATTGTTGCGTT GGAGTATAAAAACTGCGAGGTCCAGATACTGACAGCCGACGCTCAGAAATCCTTCCGCGAAGGAGTCATTGTCCTGGTGACCGGTTTCCTGACCGGAAAG GACGAGATACGAAGAAAATTCACCGAGTTGTTCTTCTTGGCTCCTCAAGAAGACGGTGGGTTCTTTGTCCTTAATGATGTTCTGAGGTACGTCGATGAAG AAGAATTGGCTGATGTAGAAGTCATTGATGCCGCTGTTGCTGATGTTGCTACTGCTGCTCCAATCGCTCCCCTTACCCCCGAACCAGAGCCAACTCCTGT TGCGGAGGAAGGTCCAGCCACTTTGGTGGCCGACGACACCATCCAACCTAATAATGAAGCGACTGTTCCGCTCGAAAATGGCAACATTGCCATTGCTGAG AAGGAGTTTGTACCGAATAATGTAATAACCGAGATGCCACAAGGCGATGCTGTAGTTGCAAAAACTCGGGAGGAAGATGTACAACAAGTTTCTCAGACCG CTGCTCCTATTTCTCAGGAAGGCGCTCCTAAAAAGTCCTATGCTTCAATTGTGCGTATATTCGTCGCGAATGCATTGAACTTGAAGGCTCAACCTTTCCA GCAGAGATTTTCACCGGCAAAACCATTGGTTCGTGCTACTGCTCCAGCTCCTGTGGTCGTAGCTGCACCAACAGCCGAGGCAGCACCGGCTCCTCGTCCT GCGAGAAATAGTTCGGTCGAAAGAACAGTGAAGGGTCACTCTATCTTCGTCGCAAATCTGCCGATGGACGCGACTGCTGACCAGCTGATCGAGACTTTGG GTAAATTCGGCCCCATCAAACCGACCGGAGTCCAAGTCAGAAGTTACAAGCAAGAGAGGAACTGTTTTGGATTTGTCGAGTTCGAAACAGCTGAAGCCGT CGAGAATGCCCTTCAGGTCGCAACCATCATGATTGGAAACCGCGAGGCCCATATCGAAAAGAAGAAAGCCGGCGGCGAAGGAGGCAAGTTCCCCCCTAGA AGGGGCGGATTCAGGAACGAAGGCTTCAGAGGCGGCCGTGGTGGTCACGGTGGCTATGCCGGAGGTCGTGGTGGTGGCAGCTACGTCAAGAATGACTTCG ACGGAAACTACTCCAGAGGAGGCGGGCGCAATGGGGAGAAAGTTTATCAGAACGGAGGGGGAAGAGGAGGACGCCAATTGAGACCGACGCAGCCACCAGC AGACGCTGCTCCAACTGAAGCCGGAAAGAATTAG
AA sequence Show only first row Show all	>Lus10004644 pacid=23176369 polypeptide=Lus10004644 locus=Lus10004644.g ID=Lus10004644.BGIv1.0 annot-version=v1.0 MTTEDSVPNAQLVGNAFVEQYYNMLSRAPENVHKFYQDSSVMSRPSSDGSMSSVSTMQGINELIVALEYKNCEVQILTADAQKSFREGVIVLVTGFLTGK DEIRRKFTELFFLAPQEDGGFFVLNDVLRYVDEEELADVEVIDAAVADVATAAPIAPLTPEPEPTPVAEEGPATLVADDTIQPNNEATVPLENGNIAIAE KEFVPNNVITEMPQGDAVVAKTREEDVQQVSQTAAPISQEGAPKKSYASIVRIFVANALNLKAQPFQQRFSPAKPLVRATAPAPVVVAAPTAEAAPAPRP ARNSSVERTVKGHSIFVANLPMDATADQLIETLGKFGPIKPTGVQVRSYKQERNCFGFVEFETAEAVENALQVATIMIGNREAHIEKKKAGGEGGKFPPR RGGFRNEGFRGGRGGHGGYAGGRGGGSYVKNDFDGNYSRGGGRNGEKVYQNGGGRGGRQLRPTQPPADAAPTEAGKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G03640			Nuclear transport factor 2 (NT...		Lus10004644 [exp]	0	1
AT3G23950			F-box family protein (.1)		Lus10040838 [exp]	1.4	0.7846
AT4G24500			hydroxyproline-rich glycoprote...		Lus10004850 [exp]	10.6	0.7637
AT3G60050			Pentatricopeptide repeat (PPR)...		Lus10014983 [exp]	12.3	0.8007
AT4G33680		AGD2	ABERRANT GROWTH AND DEATH 2, P...		Lus10000205 [exp]	15.9	0.7829
					Lus10011712 [exp]	108.6	0.6600
AT1G77130		PGSIP2, GUX3	glucuronic acid substitution o...		Lus10018922 [exp]	118.2	0.6848

Compare expression of checked genes

Lus10004644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.