Gene [FLAX] | FIBexDB

Lus10004667 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT5G24320	39 / 0.0001			Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G42010	37 / 0.0005			Transducin/WD40 repeat-like superfamily protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10011313 [exp]	99 / 2e-26	AT5G53500	129 / 1e-32	Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003206 [exp]	82 / 1e-19	AT1G64610	427 / 1e-141	Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017312 [exp]	75 / 3e-17	AT1G64610	439 / 4e-146	Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10023033 [exp]	66 / 5e-14	AT5G24320	508 / 3e-171	Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10032436 [exp]	64 / 1e-13	AT5G24320	516 / 1e-174	Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10012846 [exp]	59 / 5e-12	AT5G53500	74 / 4e-15	Transducin/WD40 repeat-like superfamily protein (.1)
Lus10000387 [exp]	42 / 1e-05	AT5G02430	53 / 1e-14	Transducin/WD40 repeat-like superfamily protein (.1)
Lus10022377 [exp]	41 / 2e-05	AT5G24320	530 / 0.0	Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10024399 [exp]	37 / 0.0004	AT2G37670	850 / 0.0	Transducin/WD40 repeat-like superfamily protein (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.003G144400 [exp]	62 / 5e-13	AT5G24320	516 / 4e-174	Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.001G086600 [exp]	57 / 3e-11	AT5G24320	514 / 1e-173	Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G174100 [exp]	47 / 1e-07	AT5G53500	523 / 1e-177	Transducin/WD40 repeat-like superfamily protein (.1)
Potri.015G009700 [exp]	39 / 8e-05	AT5G24320	621 / 0.0	Transducin/WD40 repeat-like superfamily protein (.1.2)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10004667 pacid=23176394 polypeptide=Lus10004667 locus=Lus10004667.g ID=Lus10004667.BGIv1.0 annot-version=v1.0

ATGATAACACAGTGTGCCTATGGAAAGTGGGTTGTGACAATTGATTGCCTCAAGGTTTTTCATCATAATAACTACTATAATGCGATGAGACAAGATGCTG

TAGCATGTTCACAAAGGACAACAAAACTGCCTGGCAAGAGAATAACCAGCTTTGAGTTTTCTCAATGCGATCCGAGTAGAGTGATTGTGACGTCGGCTGA

TTCGCTTTTGCAGCACGGATGTCATTTGCAAATTTAG

AA sequence

Show only first row Show all

>Lus10004667 pacid=23176394 polypeptide=Lus10004667 locus=Lus10004667.g ID=Lus10004667.BGIv1.0 annot-version=v1.0

MITQCAYGKWVVTIDCLKVFHHNNYYNAMRQDAVACSQRTTKLPGKRITSFEFSQCDPSRVIVTSADSLLQHGCHLQI

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004667 [exp]	0	1

Lus10004667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.