Lus10004674 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G55700 110 / 3e-29 UDP-Glycosyltransferase superfamily protein (.1)
AT3G55710 92 / 2e-22 UDP-Glycosyltransferase superfamily protein (.1)
AT3G11340 90 / 6e-22 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
AT5G05860 77 / 2e-17 UGT76C2 UDP-glucosyl transferase 76C2 (.1)
AT5G05900 68 / 3e-14 UDP-Glycosyltransferase superfamily protein (.1)
AT5G05890 61 / 8e-12 UDP-Glycosyltransferase superfamily protein (.1)
AT5G05880 59 / 6e-11 UDP-Glycosyltransferase superfamily protein (.1)
AT1G22340 57 / 2e-10 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1)
AT1G22360 56 / 6e-10 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 (.1.2)
AT1G22400 54 / 2e-09 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040246 253 / 7e-84 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10004671 118 / 3e-32 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1)
Lus10037268 109 / 5e-29 AT3G11340 447 / 1e-154 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10004672 84 / 1e-19 AT3G11340 417 / 1e-142 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10040244 80 / 4e-19 AT3G55700 169 / 3e-50 UDP-Glycosyltransferase superfamily protein (.1)
Lus10016460 64 / 1e-12 AT5G59590 400 / 2e-136 UDP-glucosyl transferase 76E2 (.1)
Lus10016459 63 / 2e-12 AT5G59590 357 / 3e-119 UDP-glucosyl transferase 76E2 (.1)
Lus10024584 62 / 5e-12 AT1G22400 570 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10040725 61 / 1e-11 AT5G59590 408 / 9e-140 UDP-glucosyl transferase 76E2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G195500 134 / 5e-38 AT3G11340 483 / 3e-169 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.010G195600 129 / 2e-36 AT3G55700 515 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.010G195300 120 / 4e-33 AT3G11340 485 / 6e-170 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G052232 66 / 2e-13 AT1G22360 622 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.017G052400 65 / 3e-13 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.006G039300 65 / 5e-13 AT5G59590 347 / 2e-115 UDP-glucosyl transferase 76E2 (.1)
Potri.017G052100 64 / 6e-13 AT1G22360 612 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.017G052000 62 / 5e-12 AT1G22360 617 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Potri.005G073766 58 / 1e-10 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Potri.005G073800 58 / 1e-10 AT1G22400 562 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10004674 pacid=23174261 polypeptide=Lus10004674 locus=Lus10004674.g ID=Lus10004674.BGIv1.0 annot-version=v1.0
ATGGATGGTCTTAAGCTCCCTAGAATTGTGCTTAGAACAAGCAATGTCTGTTCTTTCCTTGCATATGCTAGCTTCCCACTCTTGAGGGAGAGAGGCTATC
TTCTTCACAGCAATCAAGATCTTCAGCCAGAAGAAGATTTGCCAATGCTTCCCCCACTGAAAGTTCGAGATCTTCCCATCATCGAAACACGACAGCAAGA
AATCTTCTACCAACTGATTGTTACAGCAGTCAAGCAAATAAGGGCATCTTCAGGAATGATAATCAACACGTTTGAAGAGCTTGAGAGAGTTTCACTAGCA
ACTCTGAGCCAGGATTTCCCCCATACGCCGATCTTCACGATCAGTCCATTTCACAAGTACTTTGGAAGCTCGTCCAACAGCTTGTTAGCGCAAGACCGGA
GATAG
AA sequence
>Lus10004674 pacid=23174261 polypeptide=Lus10004674 locus=Lus10004674.g ID=Lus10004674.BGIv1.0 annot-version=v1.0
MDGLKLPRIVLRTSNVCSFLAYASFPLLRERGYLLHSNQDLQPEEDLPMLPPLKVRDLPIIETRQQEIFYQLIVTAVKQIRASSGMIINTFEELERVSLA
TLSQDFPHTPIFTISPFHKYFGSSSNSLLAQDRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G55700 UDP-Glycosyltransferase superf... Lus10004674 0 1
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10004673 1.0 0.9825
AT1G08080 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANH... Lus10014412 1.4 0.9621
AT4G23100 ATECS1, CAD2, G... ROOT MERISTEMLESS 1, PHYTOALEX... Lus10002001 7.1 0.9243
AT3G26380 Melibiase family protein (.1) Lus10011407 11.0 0.9375
AT1G51340 MATE efflux family protein (.1... Lus10042365 12.4 0.9122
AT2G28930 APK1B protein kinase 1B (.1.2.3) Lus10016537 15.0 0.9269
AT4G23290 CRK21 cysteine-rich RLK (RECEPTOR-li... Lus10028026 17.6 0.8582
AT2G46600 Calcium-binding EF-hand family... Lus10030227 17.7 0.9220
AT3G47780 ABCA7, ATATH6 A. THALIANA ABC2 HOMOLOG 6, AT... Lus10023612 19.0 0.9034
Lus10031407 19.7 0.9125

Lus10004674 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.