Lus10004677 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53980 139 / 9e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT5G05960 138 / 2e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G37870 84 / 4e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT5G48485 38 / 0.0002 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009872 164 / 2e-53 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10000397 155 / 5e-50 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10040249 92 / 8e-26 AT3G53980 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10031925 76 / 3e-18 AT2G37870 133 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10006413 45 / 2e-06 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Lus10011358 44 / 5e-06 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G196300 167 / 4e-55 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G061800 163 / 3e-53 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.016G104300 135 / 3e-42 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.008G141000 91 / 1e-24 AT2G37870 121 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G100600 83 / 1e-21 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10004677 pacid=23174259 polypeptide=Lus10004677 locus=Lus10004677.g ID=Lus10004677.BGIv1.0 annot-version=v1.0
ATGGCTGCAATGAAGTCCACCTCTTGCATTTGCCTAGTACTGGTATTCGCTGCGGTACTAGTACTTGAAACATCCAACTTTGTTACTGGAGCTGGTACCG
AGTGCGGCGCGTCCACGACCCCTGACAAGGAAGCATTCAAGCTAGCGCCCTGTGCGTCCGCCGGACAGGACCAAAACGCTGCCGTTTCGAGCCAGTGCTG
TGCTCAGATCAAGAAGCTCGGGCAGAACCCAGCTTGCCTATGTGCTGTCATGCTTTCCAACACTGCCAAAAGCTCTGGAGTTGACCCTGCCGTCGCCATG
ACTATTCCCAAACGCTGCAACCTCGCCAATCGTCCCGTTGGTTACAAGTGTGGAGATTACACATTGCCTTGA
AA sequence
>Lus10004677 pacid=23174259 polypeptide=Lus10004677 locus=Lus10004677.g ID=Lus10004677.BGIv1.0 annot-version=v1.0
MAAMKSTSCICLVLVFAAVLVLETSNFVTGAGTECGASTTPDKEAFKLAPCASAGQDQNAAVSSQCCAQIKKLGQNPACLCAVMLSNTAKSSGVDPAVAM
TIPKRCNLANRPVGYKCGDYTLP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05960 Bifunctional inhibitor/lipid-t... Lus10004677 0 1
AT5G65660 hydroxyproline-rich glycoprote... Lus10028220 3.2 0.9449
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10024583 8.1 0.9216
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Lus10036603 10.4 0.9379
AT3G53980 Bifunctional inhibitor/lipid-t... Lus10040249 13.9 0.9248
AT4G10330 glycine-rich protein (.1) Lus10001606 16.7 0.9337
AT1G02400 ATGA2OX4, ATGA2... DOWNSTREAM TARGET OF AGL15 1, ... Lus10037816 18.7 0.9320
AT1G70840 MLP31 MLP-like protein 31 (.1) Lus10020497 19.9 0.9330
Lus10004450 21.8 0.8965
AT3G11260 HD WOX5B, WOX5 WUSCHEL related homeobox 5B, W... Lus10028271 24.7 0.9241
AT2G02850 ARPN plantacyanin (.1) Lus10022800 26.0 0.9317

Lus10004677 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.