Lus10004679 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10004679 pacid=23174284 polypeptide=Lus10004679 locus=Lus10004679.g ID=Lus10004679.BGIv1.0 annot-version=v1.0
ATGGTGGTCGTGAAGAAAGTGCTCACACTTCTTCTACTTACTATGATCATCGCGCTCGTAGTTCCTCGTAGTGGTCCAATCGTTACAGAAGCAGCCAGGA
CAATCAACCAACAAGGTACGTACATATATGATAAAGTACGTACGTCTATGCTCAGGGTCTCCAAGGTTTCGCTATTGATCGGTCGTTTGATTGCAGTCGA
AGGGATGAAGCGGTCGAAGGAGGAGGTTTACTCCAAGCTCGGGTTGATATGCAAGTGTTGTGATGGAGGAAGGTGCAGTAGCTCATGGGACTCATCATGC
TCCAACCTCAAATGTTCTTCCTGGAGGAACTACTAA
AA sequence
>Lus10004679 pacid=23174284 polypeptide=Lus10004679 locus=Lus10004679.g ID=Lus10004679.BGIv1.0 annot-version=v1.0
MVVVKKVLTLLLLTMIIALVVPRSGPIVTEAARTINQQGTYIYDKVRTSMLRVSKVSLLIGRLIAVEGMKRSKEEVYSKLGLICKCCDGGRCSSSWDSSC
SNLKCSSWRNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004679 0 1
AT3G53150 UGT73D1 UDP-glucosyl transferase 73D1 ... Lus10014401 1.0 0.9143
AT1G69630 F-box/RNI-like superfamily pro... Lus10023042 2.0 0.9069
AT2G01800 COP1-interacting protein-relat... Lus10000702 3.9 0.8964
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10012395 4.5 0.8772
AT1G75620 glyoxal oxidase-related protei... Lus10024312 6.5 0.9060
AT4G12010 Disease resistance protein (TI... Lus10006789 6.9 0.8645
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10017431 7.3 0.8798
AT5G48380 BIR1 BAK1-interacting receptor-like... Lus10036697 8.9 0.9020
AT5G50890 alpha/beta-Hydrolases superfam... Lus10001506 9.9 0.8738
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10025410 10.7 0.8866

Lus10004679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.