Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39851 52 / 7e-10 Proteinase inhibitor, propeptide (.1) AT4G10550 44 / 6e-06 Subtilase family protein (.1.2.3) AT1G71950 42 / 7e-06 Proteinase inhibitor, propeptide (.1) AT1G04110 43 / 9e-06 SDD1 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) AT3G20930 42 / 2e-05 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G20150 41 / 5e-05 Subtilisin-like serine endopeptidase family protein (.1) AT1G32960 40 / 0.0001 ATSBT3.3 Subtilase family protein (.1) AT1G32940 40 / 0.0002 ATSBT3.5 Subtilase family protein (.1) AT4G15040 39 / 0.0002 Subtilisin-like serine endopeptidase family protein (.1) AT4G10540 38 / 0.0007 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002244 [exp] 49 / 2e-07 AT5G67360 567 / 0.0 Subtilase family protein (.1) Lus10040251 [exp] 46 / 1e-06 AT5G59190 438 / 6e-143 subtilase family protein (.1) Lus10041382 [exp] 44 / 4e-06 AT1G01900 825 / 0.0 subtilase family protein (.1) Lus10036546 [exp] 44 / 7e-06 AT1G01900 822 / 0.0 subtilase family protein (.1) Lus10029575 [exp] 43 / 1e-05 AT5G67360 552 / 0.0 Subtilase family protein (.1) Lus10029570 [exp] 43 / 1e-05 AT5G67360 550 / 0.0 Subtilase family protein (.1) Lus10006693 [exp] 43 / 1e-05 AT5G67360 563 / 0.0 Subtilase family protein (.1) Lus10004685 [exp] 43 / 1e-05 AT4G00230 647 / 0.0 xylem serine peptidase 1 (.1) Lus10002964 [exp] 43 / 2e-05 AT5G59100 624 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G133200 [exp] 47 / 6e-07 AT5G59090 646 / 0.0 subtilase 4.12 (.1.2.3) Potri.002G151900 [exp] 46 / 8e-07 AT4G00230 938 / 0.0 xylem serine peptidase 1 (.1) Potri.009G038001 [exp] 45 / 2e-06 AT3G46850 794 / 0.0 Subtilase family protein (.1) Potri.003G118700 [exp] 45 / 2e-06 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.019G006570 [exp] 43 / 8e-06 AT1G04110 568 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.010G196800 [exp] 43 / 1e-05 AT5G59100 599 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.013G112800 [exp] 41 / 2e-05 AT1G71950 129 / 2e-39 Proteinase inhibitor, propeptide (.1) Potri.003G118500 [exp] 42 / 3e-05 AT1G04110 557 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.001G002200 [exp] 40 / 0.0001 AT4G26330 891 / 0.0 UNFERTILIZED EMBRYO SAC 17, Subtilisin-like serine endopeptidase family protein (.1) Potri.001G113700 [exp] 40 / 0.0001 AT1G04110 538 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0570 [flax] [poplar] PPP-I PF05922 [flax] [poplar] Inhibitor_I9 Peptidase inhibitor I9
Representative CDS sequence Show only first row Show all	>Lus10004680 pacid=23174278 polypeptide=Lus10004680 locus=Lus10004680.g ID=Lus10004680.BGIv1.0 annot-version=v1.0 ATGGCAATGGTGGCATCACCAAGATTGATCCCTATGTTACCTCTGATTGTTTTGATGCTGTGCTCTGTCAAATTTCAGTGCCAAGCACTCAGCGTTTCCA GAAAGGGCTACATTGTACTCCTTGATCCAACTCTAGTGCCATCCAACACAAGATCCGTTTACTTATCTTTTCTCACCAAGGTGCTTCTTCAAGACATCAA ACCAGAGGATTCGCTCGTGTACGCCTATAGAGAAGTTGCTTACGGATTTGCAGCAAAACTCAACGAATTCGAAGCCCGAAAGTTAACCGGTATCAAAGGT GTGCTATCTGTGAGGCCAGACCAAACATTAAACGTTGATTAA
AA sequence Show only first row Show all	>Lus10004680 pacid=23174278 polypeptide=Lus10004680 locus=Lus10004680.g ID=Lus10004680.BGIv1.0 annot-version=v1.0 MAMVASPRLIPMLPLIVLMLCSVKFQCQALSVSRKGYIVLLDPTLVPSNTRSVYLSFLTKVLLQDIKPEDSLVYAYREVAYGFAAKLNEFEARKLTGIKG VLSVRPDQTLNVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39851			Proteinase inhibitor, propepti...		Lus10004680 [exp]	0	1

Compare expression of checked genes

Lus10004680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.