Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55520 214 / 2e-71 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 102 / 1e-25 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 92 / 8e-22 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT5G48580 82 / 5e-20 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G25220 79 / 1e-18 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT5G64350 74 / 2e-17 FKP12, ATFKBP12, FKBP12 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) AT4G25340 74 / 1e-15 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT5G05420 70 / 2e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G54010 61 / 3e-11 DEI1, PAS1 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) AT5G45680 54 / 5e-09 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040280 [exp] 262 / 3e-90 AT3G55520 263 / 1e-90 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10003171 [exp] 98 / 1e-23 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 97 / 2e-23 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 93 / 5e-22 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 93 / 6e-22 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025889 [exp] 83 / 1e-20 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10003170 [exp] 82 / 4e-20 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10002339 [exp] 82 / 6e-20 AT3G25220 227 / 1e-77 FK506-binding protein 15 kD-1 (.1) Lus10038215 [exp] 84 / 5e-19 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G201600 [exp] 218 / 1e-72 AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.008G057900 [exp] 215 / 8e-72 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G149400 [exp] 100 / 8e-25 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 96 / 5e-23 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.006G033400 [exp] 87 / 6e-20 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248200 [exp] 80 / 3e-19 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.007G113100 [exp] 73 / 8e-17 AT5G64350 201 / 1e-68 ARABIDOPSIS THALIANA FK506-BINDING PROTEIN 12, FK506-binding protein 12 (.1) Potri.012G129200 [exp] 74 / 2e-15 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.015G130900 [exp] 73 / 3e-15 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.002G117200 [exp] 67 / 4e-13 AT5G48570 553 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10004714 pacid=23174247 polypeptide=Lus10004714 locus=Lus10004714.g ID=Lus10004714.BGIv1.0 annot-version=v1.0 ATGGACGATGTGATTGATTTAACTGGAGATGGAGGTGTCATGAAGAAGATTGTGAGGCGTGCAAAAGCTGATGCACTTGAGCCTTCAGAGGATCTTCCTC TTGTTGATGTTCATTACGAGGGCACATTGGCCGACACTGGCGAAGTCTTCGACACCACACATGAAGACAACAGCATCTTCTCATTTGAAATAGGAAGCGG TTCGGTTATTCGAGCATGGGACGCTGCATTGCGAACTATGAAGGTGGGGGAGGTTGCTAAGATCACTTGCAAGCCAGAGTACGCCTACGGGAGTGCAGGC TCTCCACCAGATATTCCACCAGATGCGACGCTTGTGTTTGAGGTGGAGCTAGTGGCTTGCCGGCCTCGTAAAGGTTCCAGTGCGAGCAGTGTTTCAGAGG AGCGAGCTAGGCTAGAAGAGCTGAAGAAGCAGCGGGAGATGGCGGCTGCAACAAAAGAGGAAGAGAAAAGGAAGAGAGAAGAAGCTAAAGCTGCCGCGGC TGCTCGAGTTCAGGCTAAACTAAACGCGAAGAAGGGTCCCGGGAAGGGGAAAGGCAAATCGAAGTAA
AA sequence Show only first row Show all	>Lus10004714 pacid=23174247 polypeptide=Lus10004714 locus=Lus10004714.g ID=Lus10004714.BGIv1.0 annot-version=v1.0 MDDVIDLTGDGGVMKKIVRRAKADALEPSEDLPLVDVHYEGTLADTGEVFDTTHEDNSIFSFEIGSGSVIRAWDAALRTMKVGEVAKITCKPEYAYGSAG SPPDIPPDATLVFEVELVACRPRKGSSASSVSEERARLEELKKQREMAAATKEEEKRKREEAKAAAAARVQAKLNAKKGPGKGKGKSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55520			FKBP-like peptidyl-prolyl cis-...		Lus10004714 [exp]	0	1
AT3G53990			Adenine nucleotide alpha hydro...		Lus10021104 [exp]	2.4	0.8396
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10009631 [exp]	7.0	0.7713
AT3G05670			RING/U-box protein (.1)		Lus10000086 [exp]	7.3	0.7490
AT1G50660			unknown protein		Lus10002069 [exp]	8.4	0.7741
AT3G47300		SELT	SELT-like protein precursor (....		Lus10040658 [exp]	8.6	0.8130
AT3G26100			Regulator of chromosome conden...		Lus10006455 [exp]	10.5	0.7626
AT1G56423			unknown protein		Lus10029844 [exp]	13.1	0.8126
AT1G68660			Ribosomal protein L12/ ATP-dep...		Lus10035041 [exp]	17.9	0.7798
AT1G65910	NAC	ANAC028	NAC domain containing protein ...		Lus10010037 [exp]	18.6	0.7544
AT5G39250			F-box family protein (.1)		Lus10032969 [exp]	22.7	0.7727

Compare expression of checked genes

Lus10004714 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.