Lus10004717 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16600 631 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
AT2G35710 625 / 0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
AT5G18480 105 / 3e-24 PGSIP6 plant glycogenin-like starch initiation protein 6 (.1)
AT1G08990 76 / 2e-14 PGSIP5 plant glycogenin-like starch initiation protein 5 (.1)
AT1G54940 66 / 4e-11 PGSIP4 plant glycogenin-like starch initiation protein 4 (.1)
AT3G18660 64 / 1e-10 PGSIP1, GUX1 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
AT4G33330 63 / 2e-10 PGSIP3, GUX2 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
AT1G77130 62 / 5e-10 PGSIP2, GUX3 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008518 833 / 0 AT2G35710 632 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1.2.3)
Lus10027949 95 / 1e-20 AT5G18480 635 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Lus10000817 72 / 4e-14 AT5G18480 329 / 2e-111 plant glycogenin-like starch initiation protein 6 (.1)
Lus10020890 69 / 3e-12 AT3G18660 828 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10033485 68 / 7e-12 AT3G18660 677 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Lus10028623 68 / 1e-11 AT1G77130 830 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10018922 66 / 3e-11 AT1G77130 847 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Lus10021731 66 / 4e-11 AT4G33330 803 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Lus10031507 65 / 6e-11 AT1G54940 542 / 0.0 plant glycogenin-like starch initiation protein 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G158000 654 / 0 AT4G16600 678 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.003G076800 654 / 0 AT4G16600 633 / 0.0 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Potri.013G049100 91 / 3e-19 AT5G18480 661 / 0.0 plant glycogenin-like starch initiation protein 6 (.1)
Potri.005G187900 69 / 3e-12 AT1G77130 803 / 0.0 glucuronic acid substitution of xylan 3, plant glycogenin-like starch initiation protein 2 (.1)
Potri.005G061600 67 / 2e-11 AT3G18660 863 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.005G033500 66 / 2e-11 AT1G08990 555 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
Potri.007G107200 66 / 2e-11 AT3G18660 884 / 0.0 glucuronic acid substitution of xylan 1, plant glycogenin-like starch initiation protein 1 (.1.2.3)
Potri.014G029900 66 / 3e-11 AT4G33330 791 / 0.0 glucuronic acid substitution of xylan 2, plant glycogenin-like starch initiation protein 3 (.1.2)
Potri.013G022900 65 / 6e-11 AT1G08990 561 / 0.0 plant glycogenin-like starch initiation protein 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF01501 Glyco_transf_8 Glycosyl transferase family 8
Representative CDS sequence
>Lus10004717 pacid=23162926 polypeptide=Lus10004717 locus=Lus10004717.g ID=Lus10004717.BGIv1.0 annot-version=v1.0
ATGTTGAGCTGTAATGGGTTGTTGCTGTTCTTCTTCTTAGCTCTTGCCGTGTTAGGAGGATCCGAAACAGCAGCGTTTGGGCCAGAGAAGGAGATGATGG
TTCATCAGTTGTGGCCGAAGCACAGGAATGCTTACGCGACGATGATGTACATGGGTACTCCAAGGGACTACGAGTTCTACGTTGCTACTCGCGTCCTGCT
CAGATCTTTGCGCAGTCTCTCTGTAGATGCTGATCTCGTCGTCATCGCTTCGCTCGATGTTCCTCCCCGATGGGTCCAAGCCTTGGAAAAGGAAGATGGG
GCGAGAGTGGTGAGTGTGGAAAATGTGAACAATCCGTACAAGGACCAGAGCAACTTCGACCATAGATTCAAGCTTACACTGAACAAGCTCTACGCTTGGA
GCTTGGTGGACTACGAGCGGGTTGTCATGTTGGACGCTGATAATCTCTTCCTTCGCAACACCGACGAGCTTTTCCAGTGTGGCCAGTTCTGTGCTGCGTT
CATCAACCCCTGCATTTTCCACACTGGTCTCTTTGTATTGCAGCCGTCTAATGAAGTGTTCAAAGACATGCTTCATCAACTGGAAGTGGGGAAAGACAAC
CCGGATGGTGCAGACCAAGGTTTCATCGGTGGATACTTCCCTGACTTGCTTGACAAGCCACTGTTCCACCCTCCAGCACATGGCTCCGTTGTTGCGGATG
GCTCGTATAGGCTTCCTCTTGGTTATCAGATGGATGCTTCTTACTACTACCTTAGACTCCGATGGAACGTCCCTTGTGGCCCTAACAGTGTCATAACTTT
CCCCGGTGCTTCATGGTTGAAGCCATGGTACTGGTGGTCGTGGCCCGTTCTTCCTCTAGGCATCGACTGGCACGAGAAACGTCGTCAGCATCTTGGATAT
GGAGCAGAGATGCCAATGGTGGTTATCCAATCAATACTCTACCTAGGCATCATAGCCGTGACTCGTCTAGCCCGACCAAACCTAACCAAGCTATGCTACC
GAGGAAGCAGCGACAAGAACATCATCTCCTCACTCCAATCCGGCCTAAAGGTGCTATCTTTGTGGGCGATACTTGCAGCCTACGTAACCCCATTCTTCAT
AATCCCTTGCACCCTCCACCCTCTGCTAGGCTGGTCACTCTACCTCCTCGGCACATTCGCACTCTGCTCGGTCGCCATCAACGCGTTCATGCTCCCGACG
ATCCACGTCCTGACACCATGGATTGGGATTTTCGGGGTTCTGCTCGTGATGGCGTGTCCCTGGTACACCAATGGAGTTGTGAGAGCACTTTCTGTATTCG
CCTACGCCTTCTGTGCTGCTCCAGTGCTCTGGATTTCTTCCACCAAAGTCGTCGCTAGCCTTCAGGTATCGCTCGAACGGGAAGCCTTCTTCCCTAAGCT
CGGAGAATACTCTTCGCCTTCTTCTTCGTCTTCTTCTTCCTCGCCACGCTTCGGGTTGAACAAGCTATGCTAA
AA sequence
>Lus10004717 pacid=23162926 polypeptide=Lus10004717 locus=Lus10004717.g ID=Lus10004717.BGIv1.0 annot-version=v1.0
MLSCNGLLLFFFLALAVLGGSETAAFGPEKEMMVHQLWPKHRNAYATMMYMGTPRDYEFYVATRVLLRSLRSLSVDADLVVIASLDVPPRWVQALEKEDG
ARVVSVENVNNPYKDQSNFDHRFKLTLNKLYAWSLVDYERVVMLDADNLFLRNTDELFQCGQFCAAFINPCIFHTGLFVLQPSNEVFKDMLHQLEVGKDN
PDGADQGFIGGYFPDLLDKPLFHPPAHGSVVADGSYRLPLGYQMDASYYYLRLRWNVPCGPNSVITFPGASWLKPWYWWSWPVLPLGIDWHEKRRQHLGY
GAEMPMVVIQSILYLGIIAVTRLARPNLTKLCYRGSSDKNIISSLQSGLKVLSLWAILAAYVTPFFIIPCTLHPLLGWSLYLLGTFALCSVAINAFMLPT
IHVLTPWIGIFGVLLVMACPWYTNGVVRALSVFAYAFCAAPVLWISSTKVVASLQVSLEREAFFPKLGEYSSPSSSSSSSSPRFGLNKLC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16600 Nucleotide-diphospho-sugar tra... Lus10004717 0 1
Lus10022773 1.0 0.9674
AT2G35930 PUB23 plant U-box 23 (.1) Lus10013584 1.4 0.9625
Lus10025243 3.5 0.9440
AT3G47640 bHLH PYE, bHLH047, P... POPEYE, basic helix-loop-helix... Lus10024233 4.9 0.8719
AT5G48655 RING/U-box superfamily protein... Lus10022774 7.7 0.9160
AT4G34410 AP2_ERF RRTF1 (Redox Re... redox responsive transcription... Lus10014054 8.2 0.9178
AT5G21960 AP2_ERF Integrase-type DNA-binding sup... Lus10038082 9.0 0.9081
AT1G30135 ZIM TIFY5A, JAZ8 jasmonate-zim-domain protein 8... Lus10023303 9.2 0.9115
AT3G11760 unknown protein Lus10021254 10.5 0.9063
AT1G18970 GLP4 germin-like protein 4 (.1) Lus10034191 12.6 0.9090

Lus10004717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.