Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17340 330 / 3e-115 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT5G47450 323 / 2e-112 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT3G16240 317 / 5e-110 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT3G26520 250 / 1e-83 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT2G36830 245 / 8e-82 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT2G25810 235 / 1e-77 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT1G17810 223 / 1e-72 BETA-TIP beta-tonoplast intrinsic protein (.1) AT4G01470 219 / 1e-71 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT1G73190 211 / 3e-68 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT3G47440 185 / 5e-58 TIP5;1 tonoplast intrinsic protein 5;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007796 [exp] 387 / 7e-138 AT5G47450 389 / 1e-138 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10038293 [exp] 314 / 7e-109 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10025808 [exp] 307 / 5e-106 AT3G16240 389 / 2e-138 delta tonoplast integral protein (.1) Lus10014411 [exp] 248 / 1e-82 AT2G36830 390 / 4e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10023913 [exp] 247 / 3e-82 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10022611 [exp] 243 / 5e-81 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10021510 [exp] 242 / 2e-80 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10005885 [exp] 230 / 9e-76 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1) Lus10037895 [exp] 228 / 5e-75 AT2G25810 371 / 2e-131 tonoplast intrinsic protein 4;1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G077800 [exp] 328 / 3e-114 AT4G17340 351 / 2e-123 tonoplast intrinsic protein 2;2 (.1) Potri.001G157000 [exp] 311 / 1e-107 AT4G17340 333 / 3e-116 tonoplast intrinsic protein 2;2 (.1) Potri.001G186700 [exp] 308 / 1e-106 AT3G16240 372 / 8e-132 delta tonoplast integral protein (.1) Potri.003G050900 [exp] 308 / 2e-106 AT3G16240 311 / 5e-108 delta tonoplast integral protein (.1) Potri.008G050700 [exp] 249 / 3e-83 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.010G209900 [exp] 244 / 2e-81 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.016G098200 [exp] 241 / 3e-80 AT2G36830 354 / 1e-124 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.006G121700 [exp] 241 / 3e-80 AT2G36830 345 / 6e-121 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.006G239700 [exp] 240 / 1e-79 AT2G25810 355 / 5e-125 tonoplast intrinsic protein 4;1 (.1) Potri.009G005400 [exp] 233 / 6e-77 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10004733 pacid=23162923 polypeptide=Lus10004733 locus=Lus10004733.g ID=Lus10004733.BGIv1.0 annot-version=v1.0 ATGGTGAAGATTGCATTTGGAAGCTTTGGTGATTCATTTAGTGTTGGATCCATCAAGGCTTATCTCTCCGAGTTCATCGCCACTCTTCTCTTCGTGTTTG CCGGTGTCGGTTCTGCCATTGCTTTCAATAAGCTTGCTCCGGGGGCAGCCTTAGATCCAGCTGGCTTGGTCGCGGTCGCCGTGGCACATGCATTCGCGTT GTTTGTCGGAGTGGCGATGGCAGCCAACATCTCGGGTGGCCACTTGAATCCAGCTGTCACCTTCGGATTGGCTATCGGCGGCAACATCACCATCCTAACT GGCATCTTCTACTGGGTGGCCCAGTGCCTCGGTTCCACCGTGGCATGCTTTCTCCTCCAAGTCGTCACCAATGGCCTGAGCGTCCCAACCCATGGAGTGG CGGCAGGAATGAGCGAGGTCCAAGGAGTAGTAATGGAGATCATAATCACATTCGCCCTAGTCTACACGGTCTACGCCACTGCGGCCGACCCCAAGAAGGG ATCACTCGGCACAATTGCTCCAATCGCGATCGGGTTCATCGTCGGCGCCAACATCCTCGCCGCCGGCCCCTTCAGCGGTGGATCCATGAACCCGGCCCGC TCTTTCGGCCCTGCAGTCGTTGCCGGGAGCTTCGCCGGACACTGGGTGTACTGGGTCGGCCCACTCATCGGCGGTGGGCTCGCGGGCCTAGTATACGGCG ACGTTTTCATCGGGTACCATACCCCTGTTGCAACTTCTGAGAGCTATGCTTAA
AA sequence Show only first row Show all	>Lus10004733 pacid=23162923 polypeptide=Lus10004733 locus=Lus10004733.g ID=Lus10004733.BGIv1.0 annot-version=v1.0 MVKIAFGSFGDSFSVGSIKAYLSEFIATLLFVFAGVGSAIAFNKLAPGAALDPAGLVAVAVAHAFALFVGVAMAANISGGHLNPAVTFGLAIGGNITILT GIFYWVAQCLGSTVACFLLQVVTNGLSVPTHGVAAGMSEVQGVVMEIIITFALVYTVYATAADPKKGSLGTIAPIAIGFIVGANILAAGPFSGGSMNPAR SFGPAVVAGSFAGHWVYWVGPLIGGGLAGLVYGDVFIGYHTPVATSESYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47450		ATTIP2;3, DELTA...	DELTA-TONOPLAST INTRINSIC PROT...		Lus10004733 [exp]	0	1
AT5G47450		ATTIP2;3, DELTA...	DELTA-TONOPLAST INTRINSIC PROT...		Lus10007796 [exp]	1.0	0.9909
AT3G61430		ATPIP1, PIP1;1,...	PLASMA MEMBRANE INTRINSIC PROT...		Lus10040217 [exp]	2.0	0.9401
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10005885 [exp]	3.0	0.9134
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10024770 [exp]	5.1	0.9097
AT2G30210		LAC3	laccase 3 (.1)		Lus10042249 [exp]	5.2	0.9319
AT5G12380		ANNAT8	annexin 8 (.1)		Lus10019780 [exp]	5.3	0.9237
AT2G27370		CASP3	Casparian strip membrane domai...		Lus10017008 [exp]	6.3	0.9217
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10040863 [exp]	7.7	0.9116
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10009138 [exp]	11.0	0.9018
AT5G05390		LAC12	laccase 12 (.1)		Lus10042252 [exp]	11.0	0.9156

Compare expression of checked genes

Lus10004733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.