Lus10004746 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16770 336 / 2e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G16765 301 / 9e-103 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G46490 237 / 2e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G35190 235 / 1e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G46480 184 / 2e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G46500 176 / 1e-53 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G05600 122 / 6e-32 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G11180 121 / 2e-31 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G24530 120 / 2e-31 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G13610 117 / 3e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007820 488 / 2e-175 AT4G16770 291 / 4e-98 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10034964 271 / 1e-89 AT1G35190 493 / 9e-177 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10012963 269 / 9e-89 AT1G35190 498 / 7e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10011126 214 / 2e-67 AT1G35190 415 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10043026 214 / 9e-67 AT1G35190 408 / 8e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10005037 120 / 5e-31 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10032930 118 / 1e-30 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10015573 114 / 3e-29 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10030185 114 / 6e-29 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G079600 449 / 2e-160 AT4G16770 359 / 1e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G086800 288 / 2e-96 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.018G086900 268 / 1e-88 AT1G35190 478 / 6e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.007G047100 127 / 6e-34 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Potri.006G101100 117 / 3e-30 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 115 / 3e-29 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451900 114 / 3e-29 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150100 114 / 5e-29 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.015G002800 112 / 2e-28 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G069300 112 / 3e-28 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10004746 pacid=23162938 polypeptide=Lus10004746 locus=Lus10004746.g ID=Lus10004746.BGIv1.0 annot-version=v1.0
ATGGCAGCATCCGTCGCGAAACTCCCAGTCATAAACCTCTCCTCTCCCGATAAAGTATCCACCGCCGAGTCGATTCGTAAGGCGTGCATCGACTACGGCT
TCTTCTACCTCGCGAATCACGGAGTGGAAGAAGAACTGATCCGGAGAGTGTTCGAAGAGAGCCGCAAGTTCTTCTCACTCCCGGTGGATGAGAAATCGAA
GCTGCCTAGCAAAAATCAGAGAGGATACACTGCTTTGTATGCCGAGAATCTCGATCCTGATTCCAGCTCCAGAGGCGATTCGAAGGAGAGCTTCTACGTT
GGTCCAATAGACGGAAATAAAGCTGAGCTGAACCAGTGGCCTTCTGCAGAAGTTCTTCCTTCATGGAGGTTGACGCTCGAGTCTTACTACCGAAAGGTCA
CGTCAGCTGGAACAAGATTGATCTCCTTAATTGCTCTGGCTTTGAATTTGGACGAAAATCACTTTCAGAAGATTGGTGCCTTGGATGAGCCAGAAGCATT
CCTTCGACTCATATATTATCCAGGTGAACTGGGCTGTTCGAATGAAGAGCTGTATGGTGCTTCTGCCCATTCAGACTATGGAATGATCGCATTACTGATA
GATGATGGGGTACCAGGACTCCAGGCATGTGTTGATAAATTCTTCAAGGTTTGTAGGGAGAAGTCGAGACAGCCTAGGGTATGGGAAGACGTGCCACACT
TAGACGGGTGCTTCATCGTTAACATTGGAGACATGATGGAGAGGTGGACAAATTGCTTGTTCCGGTCCACTTTGCATCGAGTAATGCCAACTGGACAAGA
ACGTTATTCCATGGCATGCTTCTTCAGTCCTAACCCGGATTGCATCATCGAGTGCTTGGAGAGTTGCTGCAGCGAGTCTTCTCCCCCAAGGTTTCCTGCC
ATACGTAGTATGGATTACTTGCAGGAGCGGTTTAGGCGTACGTATGGCTCATAG
AA sequence
>Lus10004746 pacid=23162938 polypeptide=Lus10004746 locus=Lus10004746.g ID=Lus10004746.BGIv1.0 annot-version=v1.0
MAASVAKLPVINLSSPDKVSTAESIRKACIDYGFFYLANHGVEEELIRRVFEESRKFFSLPVDEKSKLPSKNQRGYTALYAENLDPDSSSRGDSKESFYV
GPIDGNKAELNQWPSAEVLPSWRLTLESYYRKVTSAGTRLISLIALALNLDENHFQKIGALDEPEAFLRLIYYPGELGCSNEELYGASAHSDYGMIALLI
DDGVPGLQACVDKFFKVCREKSRQPRVWEDVPHLDGCFIVNIGDMMERWTNCLFRSTLHRVMPTGQERYSMACFFSPNPDCIIECLESCCSESSPPRFPA
IRSMDYLQERFRRTYGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16770 2-oxoglutarate (2OG) and Fe(II... Lus10004746 0 1
AT5G10620 methyltransferases (.1) Lus10026980 1.7 0.9015
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039428 2.0 0.9137
AT1G33970 P-loop containing nucleoside t... Lus10005300 3.7 0.8908
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10000920 3.9 0.8961
AT5G25150 TAF5 TBP-associated factor 5 (.1) Lus10033021 4.0 0.8974
AT1G69010 bHLH bHLH102, BIM2 BES1-interacting Myc-like prot... Lus10005091 5.8 0.9022
AT2G23940 Protein of unknown function (D... Lus10028450 7.5 0.8906
Lus10042562 8.9 0.8885
AT5G27830 unknown protein Lus10020660 11.0 0.8830
AT5G45110 ATNPR3, NPR3 NPR1-like protein 3 (.1) Lus10036200 12.0 0.8673

Lus10004746 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.