Lus10004755 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17486 272 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 269 / 6e-92 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 216 / 1e-70 PPPDE putative thiol peptidase family protein (.1.2)
AT2G25190 209 / 5e-68 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 203 / 5e-66 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 199 / 9e-65 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 197 / 2e-59 unknown protein
AT4G25680 87 / 1e-20 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 85 / 8e-20 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 59 / 2e-10 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007844 405 / 5e-146 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 369 / 1e-131 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 290 / 3e-96 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10043293 230 / 2e-76 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 229 / 4e-76 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10013657 227 / 3e-75 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 217 / 3e-71 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 216 / 5e-71 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10033030 216 / 1e-70 AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G154400 302 / 6e-105 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 298 / 2e-103 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.018G070600 226 / 3e-75 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 221 / 9e-73 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 220 / 2e-72 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 219 / 3e-72 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G154400 218 / 5e-72 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 218 / 8e-72 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 217 / 2e-71 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 212 / 2e-69 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10004755 pacid=23162957 polypeptide=Lus10004755 locus=Lus10004755.g ID=Lus10004755.BGIv1.0 annot-version=v1.0
ATGCATTTCTTCCCTTTCAGCTCAAGCTCACACAAGGATGGCGGGAGTCGTGTTCCGGTGTATTTGAACGTGTACGATCTCAATACTGTGAATAATTACC
TCTATTGGTTCGGCCTAGGGATCTTCCATTCCGGCATTGAAGTCCATGGTATGGAGTTTAGTTTCGGAGCACACGAGTACCCTAGCAGTGGAATATTTGA
GGTGCAACCACGAAGTTGTCCAGGCTTCATCTTCAGACGTGCAGTATTGATCGGTAAGACCAGCTTGTCCCGCTCAGAAGTTCAGGAAATGATGGAGCAT
CTCTCCGCCGAATTCCATGGTGACTGTTATCATTTGATTTCGAAGAACTGCAATCATTTCACGGAAGAAGCTTGCTTGAAACTAACGGGGAAGGCAGTCC
CTGGATGGGTTAATCGGTTGGCTCGATTAGGTTCTTTCTGCAATTGTCTACTGCCAGAAAGCATTAAGGTTGCACCAGTTCAACATTTACCCGAACGCGC
AGCACATAACAATGACGACGATGCCACAGCATCGATCCTATCATATGCCTCATTGGCAAGCGACGAAGATAACTCGAATCACAATCTCTTGCCCATACCC
AATGGTGAGGTCTCGTTTGTGAAAGAAAAACCTATCAACCTATCAGGCTAG
AA sequence
>Lus10004755 pacid=23162957 polypeptide=Lus10004755 locus=Lus10004755.g ID=Lus10004755.BGIv1.0 annot-version=v1.0
MHFFPFSSSSHKDGGSRVPVYLNVYDLNTVNNYLYWFGLGIFHSGIEVHGMEFSFGAHEYPSSGIFEVQPRSCPGFIFRRAVLIGKTSLSRSEVQEMMEH
LSAEFHGDCYHLISKNCNHFTEEACLKLTGKAVPGWVNRLARLGSFCNCLLPESIKVAPVQHLPERAAHNNDDDATASILSYASLASDEDNSNHNLLPIP
NGEVSFVKEKPINLSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10004755 0 1
AT4G09900 ATMES12 ARABIDOPSIS THALIANA METHYL ES... Lus10005298 14.5 0.8740
AT4G30360 ATCNGC17 cyclic nucleotide-gated channe... Lus10019983 18.6 0.8717
AT2G21120 Protein of unknown function (D... Lus10012716 21.0 0.8644
AT2G44140 Peptidase family C54 protein (... Lus10025609 34.2 0.8641
AT3G54010 DEI1, PAS1 PASTICCINO 1, FKBP-type peptid... Lus10021502 34.4 0.8589
AT1G77280 Protein kinase protein with ad... Lus10039518 37.6 0.8614
AT4G32300 SD2-5 S-domain-2 5 (.1) Lus10002917 38.2 0.8576
AT2G33740 CUTA Nitrogen regulatory PII-like, ... Lus10014898 42.4 0.8611
AT3G52220 unknown protein Lus10039101 47.2 0.8586
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10001316 48.4 0.8579

Lus10004755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.