Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78690 99 / 5e-27 Phospholipid/glycerol acyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004783 [exp] 146 / 2e-45 AT1G78690 353 / 2e-123 Phospholipid/glycerol acyltransferase family protein (.1) Lus10003105 [exp] 66 / 2e-15 AT1G78690 67 / 1e-14 Phospholipid/glycerol acyltransferase family protein (.1) Lus10020650 [exp] 39 / 9e-05 AT3G05510 438 / 1e-150 Phospholipid/glycerol acyltransferase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G146800 [exp] 116 / 2e-33 AT1G78690 380 / 9e-134 Phospholipid/glycerol acyltransferase family protein (.1) Potri.005G025400 [exp] 38 / 0.0002 AT3G05510 529 / 0.0 Phospholipid/glycerol acyltransferase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004768 pacid=23140501 polypeptide=Lus10004768 locus=Lus10004768.g ID=Lus10004768.BGIv1.0 annot-version=v1.0 ATGGCTGGGATTACAAGGAAGGCAGTGTTTGTTATCGTTGGTGCCTTAGCTAAAGCAGTGACAAGTCTTTTGAACAATACATCAGTCCACAATGCAGACA CTCTACTTTGTCTAGTTCGATCTCGGCCACCTGGTGTACCTCTCATCACTATTAGCAATCACATGTCAACGTTAGATGATCCTCTGATGTGGGGATTCAA GGGATTCCCAATCATGAATGCAAAATTGTTTTGA
AA sequence Show only first row Show all	>Lus10004768 pacid=23140501 polypeptide=Lus10004768 locus=Lus10004768.g ID=Lus10004768.BGIv1.0 annot-version=v1.0 MAGITRKAVFVIVGALAKAVTSLLNNTSVHNADTLLCLVRSRPPGVPLITISNHMSTLDDPLMWGFKGFPIMNAKLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G78690			Phospholipid/glycerol acyltran...		Lus10004768 [exp]	0	1
					Lus10004769 [exp]	1.7	0.8966
AT2G31260		ATAPG9, APG9	autophagy 9 (APG9) (.1)		Lus10000709 [exp]	1.7	0.8610
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Lus10005190 [exp]	3.0	0.8258
					Lus10013650 [exp]	4.2	0.8638
AT1G08030		AQC1, TPST	active quiescent center1, tyro...		Lus10016093 [exp]	4.5	0.8528
AT5G52260	MYB	ATMYB19	myb domain protein 19 (.1)		Lus10027456 [exp]	6.5	0.8411
					Lus10022938 [exp]	7.5	0.8396
AT5G44960			F-box/RNI-like/FBD-like domain...		Lus10015246 [exp]	8.4	0.8453
					Lus10024480 [exp]	8.4	0.8245
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10013916 [exp]	8.9	0.8288

Compare expression of checked genes

Lus10004768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.