Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26594 98 / 3e-27 ARR24 response regulator 24 (.1) AT3G04280 86 / 1e-22 ARR22 response regulator 22 (.1.2.3) AT2G47430 67 / 3e-14 CKI1 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) AT2G01830 60 / 2e-11 CRE1, AHK4, WOL1, WOL, ATCRE1 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) AT5G10720 55 / 8e-10 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) AT2G17820 48 / 2e-07 AHK1, ATHK1 histidine kinase 1 (.1) AT5G35750 44 / 5e-06 AHK2 histidine kinase 2 (.1) AT1G27320 44 / 6e-06 AHK3 histidine kinase 3 (.1) AT2G25180 39 / 0.0005 GARP ARR12 response regulator 12 (.1) AT4G31920 38 / 0.0005 GARP ARR10 response regulator 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005407 [exp] 98 / 3e-27 AT5G26594 135 / 2e-41 response regulator 24 (.1) Lus10028021 [exp] 81 / 1e-20 AT5G26594 99 / 3e-27 response regulator 24 (.1) Lus10029849 [exp] 61 / 1e-11 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10031600 [exp] 58 / 8e-11 AT2G47430 624 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10003686 [exp] 58 / 9e-11 AT2G01830 1330 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Lus10033746 [exp] 57 / 2e-10 AT2G47430 615 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10028992 [exp] 57 / 2e-10 AT2G01830 1337 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Lus10013250 [exp] 56 / 5e-10 AT2G01830 1282 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Lus10041891 [exp] 55 / 1e-09 AT2G17820 1561 / 0.0 histidine kinase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G024900 [exp] 112 / 3e-33 AT5G26594 121 / 2e-36 response regulator 24 (.1) Potri.009G108000 [exp] 104 / 6e-30 AT5G26594 163 / 5e-53 response regulator 24 (.1) Potri.003G177300 [exp] 106 / 1e-29 AT3G04280 96 / 8e-25 response regulator 22 (.1.2.3) Potri.002G253000 [exp] 102 / 4e-29 AT5G26594 171 / 5e-56 response regulator 24 (.1) Potri.019G025000 [exp] 102 / 5e-29 AT5G26594 117 / 2e-34 response regulator 24 (.1) Potri.003G177400 [exp] 104 / 1e-28 AT3G04280 99 / 9e-26 response regulator 22 (.1.2.3) Potri.003G172750 [exp] 90 / 1e-24 AT3G04280 80 / 1e-20 response regulator 22 (.1.2.3) Potri.001G050800 [exp] 88 / 8e-23 AT5G26594 77 / 4e-18 response regulator 24 (.1) Potri.003G172866 [exp] 89 / 8e-22 AT3G04280 85 / 2e-19 response regulator 22 (.1.2.3) Potri.001G051000 [exp] 88 / 8e-22 AT5G26594 82 / 7e-19 response regulator 24 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [flax] [poplar] CheY PF00072 [flax] [poplar] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Lus10004775 pacid=23140491 polypeptide=Lus10004775 locus=Lus10004775.g ID=Lus10004775.BGIv1.0 annot-version=v1.0 ATGAAGGTGCTAGTGGTGGACGACGAGGCGCTGGTAAGAAAGATCCACAAGGCGATGCTGGGTGAGCTTGGGATTGATGAAGTGGAGGTTGCTCCAAATG GACAGGCTGCCGTTGACCTCCATGCTAATGGAGCTTGCTTTGACCTCATCCTCATGGACCTCCACATGCCCATCATGGATGGCTCCCAAGCTACGAAGGC TCTGCGATCTATGGGGGTGAGGAGCCCGATCGTCGGGGTGACCGCGGCAAACGATTGGACGGAGTTCGTGGCGTCTGGTCTCGACGACTGCGTTCCCAAG CCACTGGTCATCGAACACATTACCAAGTATCTTAATGATCGAGCGACCTGA
AA sequence Show only first row Show all	>Lus10004775 pacid=23140491 polypeptide=Lus10004775 locus=Lus10004775.g ID=Lus10004775.BGIv1.0 annot-version=v1.0 MKVLVVDDEALVRKIHKAMLGELGIDEVEVAPNGQAAVDLHANGACFDLILMDLHMPIMDGSQATKALRSMGVRSPIVGVTAANDWTEFVASGLDDCVPK PLVIEHITKYLNDRAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	0	1
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10036457 [exp]	1.0	1.0000
AT4G13250		NYC1, NYC	NON-YELLOW COLORING 1, NAD(P)-...		Lus10034917 [exp]	2.4	0.9875
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	2.4	1.0000
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	2.4	1.0000
AT3G07070			Protein kinase superfamily pro...		Lus10011866 [exp]	2.8	0.9703
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10042370 [exp]	3.2	0.9876
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	3.5	1.0000
AT4G15610			Uncharacterised protein family...		Lus10033972 [exp]	4.2	0.9626
AT5G04347			Plant self-incompatibility pro...		Lus10016171 [exp]	4.8	0.8672
AT3G43860		ATGH9A4	glycosyl hydrolase 9A4 (.1)		Lus10009794 [exp]	5.3	0.9827

Compare expression of checked genes

Lus10004775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.