Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004411 [exp] 116 / 1e-34 ND 37 / 9e-04 Lus10032581 [exp] 56 / 5e-11 ND 40 / 7e-05 Lus10043166 [exp] 52 / 1e-09 ND 40 / 6e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G362000 [exp] 45 / 3e-07 AT4G16447 50 / 8e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004778 pacid=23140497 polypeptide=Lus10004778 locus=Lus10004778.g ID=Lus10004778.BGIv1.0 annot-version=v1.0 ATGAGGCCACAAAGTGAGTTCTTCCGCTTCTTCGCTGACTCAGAAGCGCAGATCGTCATACCACATGAGGCCTCCAGTTTCTTTCTCTCTGAACTCATCT TTTCATCCAAGCAGCCACAGATTTCGCCCAACAAACTTCTCAAACACTCCCCTTTCTATCTCCACCAGACAATGGAAGGGCGTTATGCTGATCTTCAACT CGGAAGCATCCCAAACTTTCCTAATCTGCACTCTACAAATGTACTAATGCACAACACTCACTTTTGTCACTTTGATGAATCAGATGTTGATTCCTCTCTT CATCTCTGA
AA sequence Show only first row Show all	>Lus10004778 pacid=23140497 polypeptide=Lus10004778 locus=Lus10004778.g ID=Lus10004778.BGIv1.0 annot-version=v1.0 MRPQSEFFRFFADSEAQIVIPHEASSFFLSELIFSSKQPQISPNKLLKHSPFYLHQTMEGRYADLQLGSIPNFPNLHSTNVLMHNTHFCHFDESDVDSSL HL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004778 [exp]	0	1
AT2G34930			disease resistance family prot...		Lus10001035 [exp]	1.4	0.9485
AT5G62670		AHA11	H\(+\)-ATPase 11, H\(+\)-ATPas...		Lus10028203 [exp]	1.7	0.9503
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Lus10026156 [exp]	2.2	0.9363
					Lus10014515 [exp]	3.5	0.9184
AT5G16990			Zinc-binding dehydrogenase fam...		Lus10030085 [exp]	3.9	0.9155
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10037934 [exp]	4.1	0.9123
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10018138 [exp]	4.6	0.9397
AT2G45910			U-box domain-containing protei...		Lus10018835 [exp]	4.9	0.9340
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10009480 [exp]	4.9	0.9329
AT5G05570			transducin family protein / WD...		Lus10001254 [exp]	5.2	0.9292

Compare expression of checked genes

Lus10004778 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.