Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39190 77 / 4e-19 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39130 77 / 5e-19 RmlC-like cupins superfamily protein (.1) AT5G39160 76 / 1e-18 RmlC-like cupins superfamily protein (.1.2.3) AT5G39110 73 / 1e-17 RmlC-like cupins superfamily protein (.1) AT5G38960 69 / 4e-16 RmlC-like cupins superfamily protein (.1) AT5G39120 69 / 6e-16 RmlC-like cupins superfamily protein (.1) AT5G39150 68 / 8e-16 RmlC-like cupins superfamily protein (.1) AT5G39180 68 / 8e-16 RmlC-like cupins superfamily protein (.1) AT3G04200 66 / 6e-15 RmlC-like cupins superfamily protein (.1) AT3G05950 66 / 7e-15 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003114 [exp] 110 / 6e-32 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006543 [exp] 110 / 6e-32 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10003116 [exp] 100 / 4e-28 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10033767 [exp] 99 / 2e-27 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Lus10006538 [exp] 97 / 8e-27 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1) Lus10006536 [exp] 94 / 2e-25 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Lus10000622 [exp] 91 / 1e-24 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1) Lus10000346 [exp] 87 / 7e-22 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1) Lus10006535 [exp] 84 / 5e-21 AT5G05340 241 / 1e-77 Peroxidase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G026700 [exp] 90 / 4e-24 AT3G05950 286 / 1e-98 RmlC-like cupins superfamily protein (.1) Potri.019G025800 [exp] 89 / 6e-24 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G025900 [exp] 89 / 6e-24 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026000 [exp] 89 / 6e-24 AT3G05950 288 / 3e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026400 [exp] 88 / 3e-23 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026500 [exp] 88 / 3e-23 AT3G05950 288 / 2e-99 RmlC-like cupins superfamily protein (.1) Potri.019G026200 [exp] 88 / 3e-23 AT3G05950 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Potri.013G063101 [exp] 79 / 2e-20 AT5G39130 238 / 2e-80 RmlC-like cupins superfamily protein (.1) Potri.013G063200 [exp] 78 / 1e-19 AT5G39130 228 / 5e-76 RmlC-like cupins superfamily protein (.1) Potri.013G063001 [exp] 77 / 3e-19 AT5G39130 284 / 6e-98 RmlC-like cupins superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004780 pacid=23140494 polypeptide=Lus10004780 locus=Lus10004780.g ID=Lus10004780.BGIv1.0 annot-version=v1.0 ATGCAGGCTAACATAGAGGACTTCTCCTTCAAAGGACTTAACGTCCCCAGAGACACATCCTCAAACAAAGTAGGTTCGAACGTTACTCTTTTGAACGTCG ACCAGATTCCAGGGCTCAACACCTTAGGGATCTCTTTGGCTCGTCTCGACTACGCTCCCAATGGACAAGGATATAGTGGCTGGTCTACAGAAGAAGTTTG CCAATAA
AA sequence Show only first row Show all	>Lus10004780 pacid=23140494 polypeptide=Lus10004780 locus=Lus10004780.g ID=Lus10004780.BGIv1.0 annot-version=v1.0 MQANIEDFSFKGLNVPRDTSSNKVGSNVTLLNVDQIPGLNTLGISLARLDYAPNGQGYSGWSTEEVCQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39190		ATGER2, GLP2A	GERMIN-LIKE PROTEIN 2A, A. THA...		Lus10004780 [exp]	0	1
AT5G39150			RmlC-like cupins superfamily p...		Lus10003114 [exp]	5.6	0.8573
AT5G38200			Class I glutamine amidotransfe...		Lus10035996 [exp]	13.0	0.8350
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10031234 [exp]	21.9	0.8098
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Lus10009417 [exp]	26.4	0.7745
AT1G01800			NAD(P)-binding Rossmann-fold s...		Lus10006895 [exp]	34.9	0.8164
AT2G33770		ATUBC24, UBC24,...	UBIQUITIN-CONJUGATING ENZYME 2...		Lus10001214 [exp]	45.7	0.8079
AT4G28940			Phosphorylase superfamily prot...		Lus10034939 [exp]	46.5	0.8105
AT3G02850		SKOR	STELAR K+ outward rectifier, S...		Lus10015687 [exp]	48.8	0.7765
AT5G05340			Peroxidase superfamily protein...		Lus10009936 [exp]	59.4	0.7547
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Lus10030078 [exp]	75.9	0.7721

Compare expression of checked genes

Lus10004780 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.