Lus10004795 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038606 138 / 2e-41 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1)
Lus10037892 137 / 6e-41 AT3G06240 107 / 7e-26 F-box family protein (.1)
Lus10006403 37 / 0.0003 AT3G07870 362 / 2e-124 F-box and associated interaction domains-containing protein (.1)
Lus10012355 37 / 0.0007 AT3G07870 393 / 2e-135 F-box and associated interaction domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G121200 62 / 1e-12 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10004795 pacid=23168926 polypeptide=Lus10004795 locus=Lus10004795.g ID=Lus10004795.BGIv1.0 annot-version=v1.0
ATGGGGTTCCGATTGGGAGAAGATCGGTTCACGGAGCTGGAGCTGCAGAAGAGCTTGGAAATGGAGAGTCCGACCTTCTTAACGATGAGTTCATACAAGG
AATCGACGATTGCAGTGTTTAGGAGGAACTACTTGACCCGATCGGATAATGAGATATGGGTGATGTCGGAGTACGGGCGATTGGGTTCGTGGGTGAGATT
GTTGACCGTGGGGGTGTACGATAACGGGGTACCGAGGTGA
AA sequence
>Lus10004795 pacid=23168926 polypeptide=Lus10004795 locus=Lus10004795.g ID=Lus10004795.BGIv1.0 annot-version=v1.0
MGFRLGEDRFTELELQKSLEMESPTFLTMSSYKESTIAVFRRNYLTRSDNEIWVMSEYGRLGSWVRLLTVGVYDNGVPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004795 0 1
AT5G38050 RNA polymerase II transcriptio... Lus10009106 28.5 0.5929
AT1G02790 PGA4 polygalacturonase 4 (.1) Lus10016823 33.0 0.5506
AT5G19090 Heavy metal transport/detoxifi... Lus10029942 55.5 0.5564
AT3G24860 Trihelix Homeodomain-like superfamily p... Lus10004091 93.5 0.5434
AT2G16940 Splicing factor, CC1-like (.1.... Lus10025075 112.9 0.4774

Lus10004795 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.