Lus10004798 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29040 75 / 6e-17 RPT2A regulatory particle AAA-ATPase 2A (.1)
AT2G20140 75 / 6e-17 RPT2b regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
AT5G20000 49 / 6e-08 RPT6A AAA-type ATPase family protein (.1)
AT5G19990 49 / 6e-08 ATSUG1, RPT6A regulatory particle triple-A ATPase 6A (.1)
AT1G09100 39 / 0.0003 RPT5B 26S proteasome AAA-ATPase subunit RPT5B (.1)
AT3G05530 39 / 0.0003 ATS6A.2, RPT5A regulatory particle triple-A ATPase 5A (.1)
AT1G53780 39 / 0.0004 peptidyl-prolyl cis-trans isomerases;hydrolases;nucleoside-triphosphatases;ATP binding;nucleotide binding;ATPases (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022834 81 / 5e-19 AT2G20140 735 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10011901 81 / 5e-19 AT2G20140 844 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10001313 77 / 1e-17 AT4G29040 673 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Lus10019995 77 / 2e-17 AT2G20140 827 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10015524 76 / 2e-17 AT2G20140 659 / 0.0 regulatory particle AAA-ATPase 2b, AAA-type ATPase family protein (.1)
Lus10006976 76 / 4e-17 AT4G29040 828 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Lus10033055 49 / 8e-08 AT5G19990 749 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Lus10017762 49 / 8e-08 AT5G19990 797 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Lus10020654 39 / 0.0003 AT3G05530 783 / 0.0 regulatory particle triple-A ATPase 5A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G252600 78 / 6e-18 AT4G29040 838 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.014G194700 76 / 2e-17 AT4G29040 829 / 0.0 regulatory particle AAA-ATPase 2A (.1)
Potri.010G098300 49 / 7e-08 AT5G19990 768 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Potri.008G144100 49 / 7e-08 AT5G19990 741 / 0.0 regulatory particle triple-A ATPase 6A (.1)
Potri.013G016800 39 / 0.0003 AT3G05530 800 / 0.0 regulatory particle triple-A ATPase 5A (.1)
Potri.005G025100 39 / 0.0003 AT3G05530 795 / 0.0 regulatory particle triple-A ATPase 5A (.1)
PFAM info
Representative CDS sequence
>Lus10004798 pacid=23178695 polypeptide=Lus10004798 locus=Lus10004798.g ID=Lus10004798.BGIv1.0 annot-version=v1.0
ATGAACCTTGTAACTTGGTACGGTGCACTTCCAGCATGTAAAGTGCACCTTGGTAGAGTGCATTTCCATGAACCATGCACCTTAGTATGGAGAAGTTCCA
CCATGTACATTGCACTATTCACTTCTATGGTGAATTTCTACCGTGCACCTTGGTACATTGCACTTCCACCTTTCACGGTACTCTCCGTGGTTGGTCTTCT
TAACGATGTTGATCCAATGGTGCCAGTCATGAAAGTGGAATCGGCTCCACGAGAGTCTTATGCATACATTGGTGGTTTAGATGCTCATATACAAGAAATC
AAAAAATCAGCTAAGCTTCCATTGACTCTTTGA
AA sequence
>Lus10004798 pacid=23178695 polypeptide=Lus10004798 locus=Lus10004798.g ID=Lus10004798.BGIv1.0 annot-version=v1.0
MNLVTWYGALPACKVHLGRVHFHEPCTLVWRSSTMYIALFTSMVNFYRAPWYIALPPFTVLSVVGLLNDVDPMVPVMKVESAPRESYAYIGGLDAHIQEI
KKSAKLPLTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29040 RPT2A regulatory particle AAA-ATPase... Lus10004798 0 1

Lus10004798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.