Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43490 98 / 3e-25 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6) AT3G59570 78 / 4e-18 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G132900 [exp] 102 / 1e-26 AT2G43490 808 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6) Potri.017G023200 [exp] 99 / 2e-25 AT2G43490 795 / 0.0 Ypt/Rab-GAP domain of gyp1p superfamily protein (.1.2.3.4.5.6)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004801 pacid=23178698 polypeptide=Lus10004801 locus=Lus10004801.g ID=Lus10004801.BGIv1.0 annot-version=v1.0 ATGTCTTGCAGCAGGGAGGAGAAGCAATGGAGTTGCGGCAAACCCCGAGCAGTAAATTTGCAAAGAGTGACATCAATGGTGCGAGAGATTGGGGAGCCTT GTCTTTCTCAATCACCGATAAAGGTTAGCAGAATGCTGAAGAGGGAGAAGTGGCAGGCAACTTTTGAATGTGATGGCAAGGTGTCTGGATTTCGGAAAGT ACTCAAGTCAATTGTTCTGGGGGTTTGCTTATGGTTTCCTGTACTTTTGATGGAAACTTCTTGTTCTGGTCTTATAGAATTCCAGAGTTAG
AA sequence Show only first row Show all	>Lus10004801 pacid=23178698 polypeptide=Lus10004801 locus=Lus10004801.g ID=Lus10004801.BGIv1.0 annot-version=v1.0 MSCSREEKQWSCGKPRAVNLQRVTSMVREIGEPCLSQSPIKVSRMLKREKWQATFECDGKVSGFRKVLKSIVLGVCLWFPVLLMETSCSGLIEFQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G43490			Ypt/Rab-GAP domain of gyp1p su...		Lus10004801 [exp]	0	1
AT1G61850			phospholipases;galactolipases ...		Lus10018349 [exp]	11.4	0.8310
AT1G58350		ZW18	Putative serine esterase fami...		Lus10036215 [exp]	12.7	0.8164
AT4G24520		AR1, ATR1	ARABIDOPSIS CYTOCHROME REDUCTA...		Lus10032842 [exp]	14.2	0.7977
AT2G27900			unknown protein		Lus10009613 [exp]	28.5	0.7959
AT3G08550		ABI8, ELD1, KOB...	KOBITO, ABA INSENSITIVE 8, elo...		Lus10024182 [exp]	29.8	0.7879
AT2G20010			Protein of unknown function (D...		Lus10012970 [exp]	29.8	0.7890
AT4G35790		ATPLDDELTA	ARABIDOPSIS THALIANA PHOSPHOLI...		Lus10028402 [exp]	30.1	0.7951
AT5G54200			Transducin/WD40 repeat-like su...		Lus10027671 [exp]	31.3	0.7931
AT1G22610			C2 calcium/lipid-binding plant...		Lus10009460 [exp]	49.1	0.7848
AT1G79570			Protein kinase superfamily pro...		Lus10031173 [exp]	50.9	0.7849

Compare expression of checked genes

Lus10004801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.