Lus10004811 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G24750 117 / 6e-32 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G42220 107 / 2e-28 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G27700 62 / 2e-11 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G21045 57 / 3e-10 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G17850 42 / 7e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66170 40 / 0.0003 STR18 sulfurtransferase 18 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002485 451 / 7e-164 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10019454 105 / 3e-27 AT4G24750 390 / 2e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10043306 104 / 9e-27 AT4G24750 389 / 3e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10021032 94 / 2e-23 AT2G42220 304 / 2e-105 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10023820 93 / 1e-22 AT2G42220 302 / 1e-104 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10012566 55 / 2e-09 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10023243 54 / 9e-09 AT4G27700 305 / 7e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10008866 47 / 4e-06 AT4G27700 249 / 4e-84 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10005635 44 / 2e-05 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G100600 295 / 3e-102 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G086100 114 / 1e-30 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G059200 101 / 3e-26 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.012G020700 55 / 4e-09 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G131300 51 / 4e-08 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G008000 52 / 6e-08 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G111200 50 / 1e-07 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G106400 43 / 8e-05 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.002G014900 40 / 0.0004 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10004811 pacid=23158615 polypeptide=Lus10004811 locus=Lus10004811.g ID=Lus10004811.BGIv1.0 annot-version=v1.0
ATGGTGATTCAACTGAACCGCACACTCTCACCGAACTACTACTCCCACCACTACCCTTCCACCAAACAATCCAATCCTCACAAACGACAAACCCACATCG
CAGCAGCCTCCGCCGTCACCAATGGCCGGCAACTCATTCAGTCCGGCGTCGTCAAGCCCATTCTCCCCAAGGATGCCGCGAATGCTACTTCGTCGGAAGG
TTTCACTCTCTTGGATATAAGGCCGGAATGGGAGAGAAGCAAGGCTCGAGTTACAGAGTCCCTCCATGTCCCGCTCTTCGTCAACGATCCGGACACCGGC
CCTGTAACTCTTCTCAAGAAGTGGGTTCATTTCGGGTACATCGGACTGTGGACTGGGCAGAACTTCACCACTATGAACCCAGATTTCTTAAAGCAAGTTG
AGGCTTCAGTTCCTGATAAGAACTCTAAGCTGCTTGTAGCTTGCGGCGAAGGCCTAAGGTCAATGATGGCAGCATCGAAGCTTCACCAAGGTGGGTACAA
AAATTTGGGATGGTTAGCCGGAGGATTCAACCGTGCTGACGACGGCGACTTCCAGGGCGTTGAAGGGTCTGAGAAGTTACAGTATGCTACAATTGGGGGT
GTTTCTTATTACTTTCTTCAACTGCTTATACTCTTGCAGGCTGTAGGCAAGAACAATTGA
AA sequence
>Lus10004811 pacid=23158615 polypeptide=Lus10004811 locus=Lus10004811.g ID=Lus10004811.BGIv1.0 annot-version=v1.0
MVIQLNRTLSPNYYSHHYPSTKQSNPHKRQTHIAAASAVTNGRQLIQSGVVKPILPKDAANATSSEGFTLLDIRPEWERSKARVTESLHVPLFVNDPDTG
PVTLLKKWVHFGYIGLWTGQNFTTMNPDFLKQVEASVPDKNSKLLVACGEGLRSMMAASKLHQGGYKNLGWLAGGFNRADDGDFQGVEGSEKLQYATIGG
VSYYFLQLLILLQAVGKNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08920 Rhodanese/Cell cycle control p... Lus10004811 0 1
AT5G39530 Protein of unknown function (D... Lus10024051 1.4 0.9724
AT3G08920 Rhodanese/Cell cycle control p... Lus10002485 1.7 0.9728
AT1G64510 Translation elongation factor... Lus10023054 3.9 0.9697
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10005553 6.6 0.9683
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 7.4 0.9668
AT1G29070 Ribosomal protein L34 (.1) Lus10013928 7.7 0.9661
AT5G54600 Translation protein SH3-like f... Lus10038125 9.5 0.9628
AT2G43030 Ribosomal protein L3 family pr... Lus10001337 9.8 0.9587
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10034302 9.9 0.9659
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10015677 11.0 0.9601

Lus10004811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.