Lus10004822 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08980 190 / 1e-62 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G53530 96 / 2e-25 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
AT1G29960 84 / 1e-20 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G23465 77 / 5e-18 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G06870 59 / 1e-10 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
AT2G30440 58 / 3e-10 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1)
AT1G06200 50 / 9e-08 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G24590 50 / 1e-07 PLSP1 plastidic type i signal peptidase 1 (.1)
AT2G31140 48 / 4e-07 Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002492 318 / 4e-113 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10005571 83 / 3e-20 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10013703 83 / 8e-19 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Lus10025393 72 / 2e-16 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10032753 56 / 2e-09 AT1G06870 379 / 3e-125 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10033448 52 / 4e-09 AT1G53530 110 / 1e-32 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10023651 50 / 1e-07 AT3G24590 318 / 2e-109 plastidic type i signal peptidase 1 (.1)
Lus10034925 50 / 1e-07 AT3G24590 316 / 1e-108 plastidic type i signal peptidase 1 (.1)
Lus10011671 47 / 3e-07 AT2G30440 172 / 7e-54 plastidic type I signal peptidase 2B, thylakoid processing peptide (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G115100 226 / 1e-76 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.001G380400 94 / 7e-25 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.005G092900 94 / 8e-25 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.007G071400 84 / 6e-21 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.014G036400 61 / 2e-11 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.002G079600 52 / 2e-08 AT3G24590 177 / 3e-55 plastidic type i signal peptidase 1 (.1)
Potri.006G157900 51 / 7e-08 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1)
Potri.018G081800 50 / 2e-07 AT3G24590 372 / 3e-130 plastidic type i signal peptidase 1 (.1)
Potri.002G037900 42 / 8e-05 AT1G06200 264 / 2e-90 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.005G225100 41 / 0.0001 AT2G31140 274 / 2e-94 Peptidase S24/S26A/S26B/S26C family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0299 Peptidase_SF PF00717 Peptidase_S24 Peptidase S24-like
Representative CDS sequence
>Lus10004822 pacid=23158626 polypeptide=Lus10004822 locus=Lus10004822.g ID=Lus10004822.BGIv1.0 annot-version=v1.0
ATGGCAGCTCGTGAAGTCTTGGTTAGCGCCGCGAAGAAGTTCTTTCTTTTGGGTATCATTGGAATCCCAGTTACCGACCGATTGGCCAGCGTTGTTCCAG
TTCGGGGTCAATCAATGTCGCCGACACTTAACCCCGATTCCGATTCCCTTTTCGATGATCGGGTTCTGGTAGAGAAATTGTGCCTCCAGCGGTATAGTTT
TTCTCACGGCGACGTGGTTGTTTTCCGTTCTCCAGTTGATCATAAGGAGAAACTCGTCAAGAGGATAATTGGCTTGCCTGGTGACTGGGTTGGGACTCCT
CATACGTATGATGTGGTCAAGGTTCCAGAAGGCCATTGCTGGGTTGAGGGAGGCAATATGATTCCCAGCATGGATTCCAGATCATTTGGCCCGATTCCAT
TAGGTCTAGCGAGGGGAAGAGTGGTACGGATTGTATGGCCACCTCAAAGGATGGGGAAGGTAGAGCGAAAAGTACCGGAAGGCAGACTATGTCCTTCTAG
ATGA
AA sequence
>Lus10004822 pacid=23158626 polypeptide=Lus10004822 locus=Lus10004822.g ID=Lus10004822.BGIv1.0 annot-version=v1.0
MAAREVLVSAAKKFFLLGIIGIPVTDRLASVVPVRGQSMSPTLNPDSDSLFDDRVLVEKLCLQRYSFSHGDVVVFRSPVDHKEKLVKRIIGLPGDWVGTP
HTYDVVKVPEGHCWVEGGNMIPSMDSRSFGPIPLGLARGRVVRIVWPPQRMGKVERKVPEGRLCPSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08980 Peptidase S24/S26A/S26B/S26C f... Lus10004822 0 1
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10039717 22.2 0.6864
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10001460 26.5 0.7063
AT1G59970 Matrixin family protein (.1) Lus10014512 28.7 0.6310
Lus10021617 33.2 0.6079
AT2G02955 MEE12 maternal effect embryo arrest ... Lus10030475 43.3 0.6169
Lus10010342 50.3 0.7210
AT1G79500 ATKDSA1, KDSA Aldolase-type TIM barrel famil... Lus10027741 65.7 0.6253
Lus10015674 66.2 0.6965
AT1G21270 WAK2 wall-associated kinase 2 (.1) Lus10013385 82.3 0.6066
AT5G25340 Ubiquitin-like superfamily pro... Lus10041040 104.1 0.6773

Lus10004822 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.