Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08990 70 / 2e-16 Yippee family putative zinc-binding protein (.1.2) AT4G27745 62 / 2e-13 Yippee family putative zinc-binding protein (.1) AT3G11230 62 / 3e-13 Yippee family putative zinc-binding protein (.1.2) AT2G40110 61 / 5e-13 Yippee family putative zinc-binding protein (.1.2) AT3G55890 56 / 5e-11 Yippee family putative zinc-binding protein (.1) AT4G27740 54 / 1e-10 Yippee family putative zinc-binding protein (.1) AT5G53940 52 / 1e-09 Yippee family putative zinc-binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023791 [exp] 104 / 4e-30 AT2G40110 62 / 2e-13 Yippee family putative zinc-binding protein (.1.2) Lus10008833 [exp] 85 / 7e-22 AT2G40110 54 / 8e-10 Yippee family putative zinc-binding protein (.1.2) Lus10022354 [exp] 73 / 1e-17 AT2G40110 57 / 1e-11 Yippee family putative zinc-binding protein (.1.2) Lus10022355 [exp] 70 / 2e-16 AT3G11230 62 / 4e-13 Yippee family putative zinc-binding protein (.1.2) Lus10007773 [exp] 69 / 2e-16 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1) Lus10033226 [exp] 69 / 3e-16 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1) Lus10000335 [exp] 67 / 2e-15 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1) Lus10028300 [exp] 65 / 2e-14 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2) Lus10040190 [exp] 64 / 8e-14 AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G145400 [exp] 67 / 1e-15 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1) Potri.001G085400 [exp] 67 / 2e-15 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1) Potri.015G009200 [exp] 66 / 3e-15 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1) Potri.012G019100 [exp] 66 / 5e-15 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1) Potri.010G190000 [exp] 62 / 3e-13 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2) Potri.011G115700 [exp] 61 / 4e-13 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1) Potri.008G067100 [exp] 60 / 4e-12 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2) Potri.006G015500 [exp] 57 / 2e-11 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2) Potri.014G101600 [exp] 56 / 3e-11 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1) Potri.016G115000 [exp] 56 / 6e-11 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0080 [flax] [poplar] Beta-tent PF03226 [flax] [poplar] Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence Show only first row Show all	>Lus10004823 pacid=23158614 polypeptide=Lus10004823 locus=Lus10004823.g ID=Lus10004823.BGIv1.0 annot-version=v1.0 ATGCCCGGGAAAAGCAAAGTCAAAGTACACCCGTTCGAGCATCTGGCAAAAGGAGCCCACAGCTGCAAGCAGTGCAGCACTCATGTCGCCAGTGAAGCAG AGAAATTCTCCACCGAGGCGCTCCGAGGCGCTAATAGTGGACTGGCCGATCTCTTTACTACCGCTATCAATGTCATATATGGGCTGCCACGTCACCGCAA CATGGGGGTAGGAAGTCATTTTGGGATGGACATACATTGTGCTGATTGTCGCTCAGTCATTGGCTGGAAATCTACTGTCACGTATAACATCATGGAGAAG GATAAAGAAGGCAGATACCTGCTGGATAGGAATAACGTGGCGGATCCAGGTCCTAATGCTTGA
AA sequence Show only first row Show all	>Lus10004823 pacid=23158614 polypeptide=Lus10004823 locus=Lus10004823.g ID=Lus10004823.BGIv1.0 annot-version=v1.0 MPGKSKVKVHPFEHLAKGAHSCKQCSTHVASEAEKFSTEALRGANSGLADLFTTAINVIYGLPRHRNMGVGSHFGMDIHCADCRSVIGWKSTVTYNIMEK DKEGRYLLDRNNVADPGPNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G08990			Yippee family putative zinc-bi...		Lus10004823 [exp]	0	1
AT4G39830			Cupredoxin superfamily protein...		Lus10009603 [exp]	1.0	0.9995
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002831 [exp]	2.4	0.9979
AT3G24503		ALDH1A, REF1, A...	REDUCED EPIDERMAL FLUORESCENCE...		Lus10024260 [exp]	3.0	0.9960
AT5G39160			RmlC-like cupins superfamily p...		Lus10034254 [exp]	3.5	0.9960
					Lus10009892 [exp]	3.9	0.9939
AT5G58850	MYB	ATMYB119	myb domain protein 119 (.1)		Lus10018220 [exp]	5.2	0.9668
AT1G13680			PLC-like phosphodiesterases su...		Lus10000649 [exp]	5.3	0.9795
AT2G23945			Eukaryotic aspartyl protease f...		Lus10031113 [exp]	5.5	0.9853
AT5G44390			FAD-binding Berberine family p...		Lus10042382 [exp]	7.7	0.9613
					Lus10019151 [exp]	8.5	0.9685

Compare expression of checked genes

Lus10004823 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.