Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38140 61 / 1e-12 PSRP4 plastid-specific ribosomal protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002497 [exp] 122 / 8e-37 AT2G38140 72 / 2e-17 plastid-specific ribosomal protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G113700 [exp] 76 / 7e-19 AT2G38140 73 / 1e-17 plastid-specific ribosomal protein 4 (.1) Potri.009G124700 [exp] 37 / 0.0003 AT2G21290 45 / 1e-07 unknown protein Potri.004G163100 [exp] 37 / 0.0007 AT2G21290 41 / 6e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004829 pacid=23158623 polypeptide=Lus10004829 locus=Lus10004829.g ID=Lus10004829.BGIv1.0 annot-version=v1.0 ATGGCGTCCCTGATGTTGGCAGCACTTCCACCTGCCACGCTTCGTTCCCTCAACTTCTGCTCTCGCTTCTCCTCCTTTCGTTCGAAGTCTGGAGTCACTT CCATCGTTGCATCATTCGATTCGCTCACCGTCTCCGCATCTTCTTCCTCCCCGTCATCACTTCCGCTGGTGGCTTGTGGCAGAGGCGATAGGAGGACTGC CAAAGGAAAGCGGTTAAGTCATTCGTTTGGAAATGCGAGGCCTAGGAACAAGAAGAAAGGGAGAGGACCGCCGAGGATACCGGTTCCTGCCTCTCCTTTG ACTCCTGATGCTCCTTTGGATCCTAATGAATTGGTAGAGGACAGTGAAGTAGTCTCCACTGAAGTCACTGAGTGA
AA sequence Show only first row Show all	>Lus10004829 pacid=23158623 polypeptide=Lus10004829 locus=Lus10004829.g ID=Lus10004829.BGIv1.0 annot-version=v1.0 MASLMLAALPPATLRSLNFCSRFSSFRSKSGVTSIVASFDSLTVSASSSSPSSLPLVACGRGDRRTAKGKRLSHSFGNARPRNKKKGRGPPRIPVPASPL TPDAPLDPNELVEDSEVVSTEVTE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38140		PSRP4	plastid-specific ribosomal pro...		Lus10004829 [exp]	0	1
AT4G15620			Uncharacterised protein family...		Lus10041528 [exp]	1.7	0.9512
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029575 [exp]	4.2	0.9424
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014690 [exp]	5.3	0.9378
AT1G47720		OSB1	Organellar Single-stranded, Pr...		Lus10018763 [exp]	6.2	0.8915
AT3G09860			unknown protein		Lus10023014 [exp]	6.3	0.9101
AT2G32180		PTAC18	plastid transcriptionally acti...		Lus10030017 [exp]	8.9	0.9322
AT1G29930		LHCB1.3, CAB140...	LIGHT-HARVESTING CHLOROPHYLL A...		Lus10007362 [exp]	9.3	0.9401
AT1G79915			Putative methyltransferase fam...		Lus10025778 [exp]	9.9	0.8664
AT4G17810	C2H2ZnF	ZFP12	C2H2 and C2HC zinc fingers sup...		Lus10040083 [exp]	10.8	0.9304
AT1G14960			Polyketide cyclase/dehydrase a...		Lus10042489 [exp]	12.0	0.9376

Compare expression of checked genes

Lus10004829 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.