Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATMG00650 72 / 4e-18 ATMG00650.1, NAD4L NADH dehydrogenase subunit 4L (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G062622 [exp] 69 / 3e-17 ATMG00650 125 / 4e-39 NADH dehydrogenase subunit 4L (.1) Potri.007G061661 [exp] 69 / 3e-17 ATMG00650 125 / 4e-39 NADH dehydrogenase subunit 4L (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004838 pacid=23158625 polypeptide=Lus10004838 locus=Lus10004838.g ID=Lus10004838.BGIv1.0 annot-version=v1.0 ATGATGGGTCAATCATTTGCTTCATTGGTTCCAACGGTAGCAGCTGCGGAATCTACTATTGGGTTAGCCATTTTCGTTATTATCCGAGTCCGAGGGACTA TTGCTGTAGAATTTAGTACTAGCATTCAAGGGTCAGGGCCTTTCTCGCTGGGCGAGCCGACTCGTAAGTCCTTTCCTAAACCACTTCCCGGTCAGTTGCT GAAAGATAGAGAGAAGCTTTCTAAATGA
AA sequence Show only first row Show all	>Lus10004838 pacid=23158625 polypeptide=Lus10004838 locus=Lus10004838.g ID=Lus10004838.BGIv1.0 annot-version=v1.0 MMGQSFASLVPTVAAAESTIGLAIFVIIRVRGTIAVEFSTSIQGSGPFSLGEPTRKSFPKPLPGQLLKDREKLSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
ATMG00650		ATMG00650.1, NA...	NADH dehydrogenase subunit 4L ...		Lus10004838 [exp]	0	1
ATMG01360		ATMG01360.1, CO...	cytochrome oxidase (.1)		Lus10009204 [exp]	2.0	0.9867
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10015033 [exp]	3.5	0.9861
ATMG00080		ATMG00080.1, RP...	ribosomal protein L16 (.1)		Lus10004083 [exp]	3.7	0.9812
					Lus10008200 [exp]	4.5	0.9670
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10000460 [exp]	4.6	0.9839
ATMG01360		ATMG01360.1, CO...	cytochrome oxidase (.1)		Lus10004084 [exp]	4.9	0.9838
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10009720 [exp]	5.5	0.9831
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10000459 [exp]	6.0	0.9818
ATCG00020		ATCG00020.1, PS...	photosystem II reaction center...		Lus10004895 [exp]	6.9	0.9601
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10000087 [exp]	8.0	0.9767

Compare expression of checked genes

Lus10004838 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.