Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14930 99 / 3e-25 GENE101, SAG101 senescence-associated gene 101 (.1.2.3) AT3G52430 54 / 3e-09 PAD4, ATPAD4 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1) AT3G48090 49 / 1e-07 ATEDS1, EDS1 enhanced disease susceptibility 1, alpha/beta-Hydrolases superfamily protein (.1.2) AT3G48080 49 / 1e-07 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011697 [exp] 236 / 1e-76 AT5G14930 255 / 4e-78 senescence-associated gene 101 (.1.2.3) Lus10009502 [exp] 234 / 4e-75 AT5G14930 299 / 5e-94 senescence-associated gene 101 (.1.2.3) Lus10039444 [exp] 159 / 5e-46 AT3G01380 1238 / 0.0 transferases;sulfuric ester hydrolases;catalytics;transferases (.1) Lus10039472 [exp] 152 / 4e-45 AT5G14930 223 / 1e-66 senescence-associated gene 101 (.1.2.3) Lus10032169 [exp] 134 / 1e-37 AT5G14930 314 / 7e-100 senescence-associated gene 101 (.1.2.3) Lus10014518 [exp] 133 / 2e-37 AT5G14930 298 / 2e-93 senescence-associated gene 101 (.1.2.3) Lus10039617 [exp] 59 / 6e-11 AT3G52430 375 / 1e-122 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1) Lus10029534 [exp] 56 / 6e-10 AT3G52430 349 / 2e-112 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1) Lus10042937 [exp] 46 / 1e-06 AT3G48090 416 / 2e-138 enhanced disease susceptibility 1, alpha/beta-Hydrolases superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G290600 [exp] 132 / 4e-37 AT5G14930 328 / 2e-105 senescence-associated gene 101 (.1.2.3) Potri.019G005256 [exp] 129 / 4e-36 AT5G14930 317 / 3e-101 senescence-associated gene 101 (.1.2.3) Potri.019G007227 [exp] 125 / 1e-34 AT5G14930 300 / 3e-94 senescence-associated gene 101 (.1.2.3) Potri.009G086100 [exp] 125 / 1e-34 AT5G14930 309 / 4e-98 senescence-associated gene 101 (.1.2.3) Potri.012G074700 [exp] 58 / 1e-10 AT3G48080 426 / 7e-142 alpha/beta-Hydrolases superfamily protein (.1) Potri.015G069600 [exp] 55 / 1e-09 AT3G48090 424 / 2e-141 enhanced disease susceptibility 1, alpha/beta-Hydrolases superfamily protein (.1.2) Potri.007G100600 [exp] 54 / 2e-09 AT3G52430 320 / 4e-102 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1) Potri.005G068700 [exp] 50 / 6e-08 AT3G52430 327 / 2e-104 ARABIDOPSIS PHYTOALEXIN DEFICIENT 4, alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004841 pacid=23175250 polypeptide=Lus10004841 locus=Lus10004841.g ID=Lus10004841.BGIv1.0 annot-version=v1.0 ATGCGTAACAAAAAGAATGCAATGGAACCGAGTAGGAAACTAAACGAGATAAAGATAAAAGTGGTGCTCCTAGGAAGATACAAACAAGAATGCAGGAAAA AGAGAGTAGGTTACTACGACAGGTACAAGAACCAATCTACTACAGCCGACATAGACATAGCAAGGCACAAGAAACACCTGACCAACTACTGGAAACAAAT GGTTGAAGATGCCGAGAAGAAGCCTCAAAAGGATGGCTCCCACGTCCGGGTTTCGTGGCTATATGGAGGAACTACTTACAGAAGAATGGTCGAGCCACTT GACATTGCTGATTTCTACAGAGGGGGGAATTGGAACAAAAGGGATTACAAGAATCAATGA
AA sequence Show only first row Show all	>Lus10004841 pacid=23175250 polypeptide=Lus10004841 locus=Lus10004841.g ID=Lus10004841.BGIv1.0 annot-version=v1.0 MRNKKNAMEPSRKLNEIKIKVVLLGRYKQECRKKRVGYYDRYKNQSTTADIDIARHKKHLTNYWKQMVEDAEKKPQKDGSHVRVSWLYGGTTYRRMVEPL DIADFYRGGNWNKRDYKNQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	0	1
AT5G10530			Concanavalin A-like lectin pro...		Lus10020447 [exp]	1.0	0.9620
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	1.4	0.9449
AT5G45190			Cyclin family protein (.1.2)		Lus10018272 [exp]	2.0	0.9285
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028863 [exp]	3.7	0.9195
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	4.7	0.8960
					Lus10015488 [exp]	4.9	0.9194
AT1G68490			unknown protein		Lus10027557 [exp]	5.5	0.9078
AT4G05440		EDA35	embryo sac development arrest ...		Lus10000812 [exp]	6.2	0.9048
AT2G36960	MYB	TKI1	TSL-kinase interacting protein...		Lus10010230 [exp]	6.6	0.9141
AT4G24190		AtHsp90-7, HSP9...	SHEPHERD, HEAT SHOCK PROTEIN 9...		Lus10035109 [exp]	6.9	0.9076

Compare expression of checked genes

Lus10004841 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.