Lus10004843 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013110 45 / 9e-07 ND /
Lus10035007 39 / 0.0007 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10004843 pacid=23175251 polypeptide=Lus10004843 locus=Lus10004843.g ID=Lus10004843.BGIv1.0 annot-version=v1.0
ATGCCCCAGACATGGAAGGGAAAAGAACATTCATTGTCGTGCTGCTTAGGAGATGTGGCTAGTCGAGCGGTTAGCCTTGCACTTCATCTTGTTGCATACT
GTATTGTTCCCCATTTTCCTATCTGCTCTCGGCTCAAGTTCCCACCGGCTGGCATATTATGCCCGTGGAAGACCCTCTGTCATGCCTATGACGAGCCTGA
TTACGCCCGTGACTGTTGTGCCATCACTCAAGTGGTGTTCCGCTCACCACGCCCGTGGTCAGCTGTTTCAATCATTGACACTAGAGGTGGTCAGATTAGG
ATTTGTACTGACGATATGCTTAAAGAACTTGAGTTGCATCTCCACTTATCTGGGAATTTGACTTGTACTAAAGGTTATGAGATTCACGTCCTATCTATTT
GCAAAGGTGTCCATCAGATAGACGGTTCAAAGACGAAGTTAACGACTCAAGTCGGAGCTCAATCGGAGATCAAATAA
AA sequence
>Lus10004843 pacid=23175251 polypeptide=Lus10004843 locus=Lus10004843.g ID=Lus10004843.BGIv1.0 annot-version=v1.0
MPQTWKGKEHSLSCCLGDVASRAVSLALHLVAYCIVPHFPICSRLKFPPAGILCPWKTLCHAYDEPDYARDCCAITQVVFRSPRPWSAVSIIDTRGGQIR
ICTDDMLKELELHLHLSGNLTCTKGYEIHVLSICKGVHQIDGSKTKLTTQVGAQSEIK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004843 0 1
Lus10003493 7.6 0.8450
AT1G11920 Pectin lyase-like superfamily ... Lus10011257 13.2 0.8029
AT5G58880 unknown protein Lus10005869 21.0 0.8308
AT1G58370 ATXYN1, RXF12 ARABIDOPSIS THALIANA XYLANASE ... Lus10013322 22.0 0.7919
AT1G28710 Nucleotide-diphospho-sugar tra... Lus10032455 58.0 0.7565
Lus10028051 96.5 0.7679
AT3G04370 PDLP4 plasmodesmata-located protein ... Lus10027953 100.0 0.7624
AT2G26730 Leucine-rich repeat protein ki... Lus10014525 135.4 0.7631
Lus10008896 172.0 0.7804
Lus10033897 199.4 0.7715

Lus10004843 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.