Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22380 275 / 1e-93 NAC ANAC090 NAC domain containing protein 90 (.1) AT3G44350 256 / 4e-86 NAC ANAC061 NAC domain containing protein 61 (.1.2) AT1G61110 142 / 7e-41 NAC ANAC025 NAC domain containing protein 25 (.1) AT4G17980 141 / 8e-41 NAC ANAC071 NAC domain containing protein 71 (.1) AT5G46590 141 / 2e-40 NAC ANAC096 NAC domain containing protein 96 (.1) AT2G02450 142 / 3e-40 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT2G17040 139 / 3e-40 NAC ANAC036 NAC domain containing protein 36 (.1) AT4G27410 140 / 6e-40 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT3G17730 135 / 1e-38 NAC ANAC057 NAC domain containing protein 57 (.1) AT1G69490 135 / 2e-38 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020643 [exp] 498 / 0 AT5G22380 283 / 1e-96 NAC domain containing protein 90 (.1) Lus10029410 [exp] 182 / 2e-56 AT5G22380 171 / 1e-52 NAC domain containing protein 90 (.1) Lus10023208 [exp] 147 / 2e-42 AT2G02450 321 / 3e-108 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10026617 [exp] 144 / 8e-42 AT1G69490 298 / 1e-101 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10008420 [exp] 147 / 1e-41 AT2G02450 320 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10030446 [exp] 144 / 1e-41 AT1G69490 302 / 2e-103 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10008419 [exp] 146 / 5e-41 AT2G02450 327 / 7e-109 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10008897 [exp] 144 / 5e-41 AT2G02450 315 / 5e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Lus10003367 [exp] 147 / 1e-40 AT2G02450 333 / 3e-110 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G218800 [exp] 300 / 6e-103 AT5G22380 272 / 3e-92 NAC domain containing protein 90 (.1) Potri.009G019200 [exp] 284 / 5e-97 AT3G44350 257 / 1e-86 NAC domain containing protein 61 (.1.2) Potri.006G209200 [exp] 239 / 7e-79 AT5G22380 241 / 3e-80 NAC domain containing protein 90 (.1) Potri.016G076000 [exp] 231 / 6e-76 AT5G22380 226 / 4e-74 NAC domain containing protein 90 (.1) Potri.016G076100 [exp] 228 / 7e-75 AT5G22380 214 / 2e-69 NAC domain containing protein 90 (.1) Potri.003G046700 [exp] 147 / 1e-41 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.008G089000 [exp] 143 / 2e-41 AT1G69490 331 / 6e-115 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.004G230800 [exp] 143 / 2e-40 AT2G02450 311 / 2e-103 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.009G141600 [exp] 140 / 2e-40 AT2G17040 314 / 6e-108 NAC domain containing protein 36 (.1) Potri.003G089800 [exp] 142 / 4e-40 AT4G17980 319 / 6e-109 NAC domain containing protein 71 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10004846 pacid=23157185 polypeptide=Lus10004846 locus=Lus10004846.g ID=Lus10004846.BGIv1.0 annot-version=v1.0 ATGGCTGGTCAGTTCCCACCTGGCTTTCGCTTCTTCCCAACTGAAGAAGAACTGGTCTCCTTCTACCTCCATAAACAGCTGGAAGGGACGATCCAGGAGG GCTTGCACCAGGTTATACCTGTCGTCGATATTTACGCGATCGACCCATGGCACCTTCCAAGCGTAGCGGGAGAGAGATGTCGAGGAGATACGGAGCAGTG GTTCTACTTCACGCCAAGACAGGAGCGAGAAGCTCGAGGAGGGAGGCCGAATCGAACTACCGGATCGGGGTACTGGAAGGCCACTGGTTCCACGAGCTAC GTCTACTCCTCTAATAATAGAGTGATTGGAGTCAAGAAGACTATGGTGTTCTACAAGGGGAAAGCTCCAGCTGGAAGGAAAACCAAATGGAAGATGAATG AGTACAGGGCTATAGATGGAGGGCTTTCGGAGTCATCTAGTCCGCCCATCCCTCGGTTGAGGTATGAGTTCAGCCTGTGCCGAATCTACGTAGTATCAGG GACCTTTGGAGCATTTGACAGACGCCCACTGGAAGCTACAACGAGTACTAGTACTGGCGCTCAAGTTCCGAGTGACGTGCCATCATCAAGTGCTCAAGTA CCTGCTGCAGTGGTGGAGAGAACTAACTCATCTGAAACTTCCAACTCAGGAGGAGACCATGGCTTCTCTCAAGGTGCTCGAATCGCGGACATGGAGATTG CTGATTATCTGGATGAACAATTCATCGACTGGGAACAACTGGACTGGCCATGA
AA sequence Show only first row Show all	>Lus10004846 pacid=23157185 polypeptide=Lus10004846 locus=Lus10004846.g ID=Lus10004846.BGIv1.0 annot-version=v1.0 MAGQFPPGFRFFPTEEELVSFYLHKQLEGTIQEGLHQVIPVVDIYAIDPWHLPSVAGERCRGDTEQWFYFTPRQEREARGGRPNRTTGSGYWKATGSTSY VYSSNNRVIGVKKTMVFYKGKAPAGRKTKWKMNEYRAIDGGLSESSSPPIPRLRYEFSLCRIYVVSGTFGAFDRRPLEATTSTSTGAQVPSDVPSSSAQV PAAVVERTNSSETSNSGGDHGFSQGARIADMEIADYLDEQFIDWEQLDWP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Lus10004846 [exp]	0	1
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015354 [exp]	1.0	0.9345
AT1G71690			Protein of unknown function (D...		Lus10003512 [exp]	1.4	0.9257
AT3G42770			F-box/RNI-like/FBD-like domain...		Lus10021833 [exp]	2.0	0.8966
AT5G64810	WRKY	ATWRKY51, WRKY5...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10035841 [exp]	3.9	0.9182
					Lus10011661 [exp]	4.2	0.8939
AT1G29380			Carbohydrate-binding X8 domain...		Lus10025379 [exp]	4.5	0.8949
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10037147 [exp]	5.7	0.8832
AT3G55390			Uncharacterised protein family...		Lus10001709 [exp]	7.1	0.8562
AT5G48290			Heavy metal transport/detoxifi...		Lus10016062 [exp]	8.8	0.8833
AT1G76430		PHT1;9	phosphate transporter 1;9 (.1)		Lus10016042 [exp]	10.7	0.8533

Compare expression of checked genes

Lus10004846 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.