Lus10004848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27750 50 / 1e-07 F-box/FBD-like domains containing protein (.1)
AT1G13780 49 / 3e-07 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT2G04230 46 / 3e-06 FBD, F-box and Leucine Rich Repeat domains containing protein (.1)
AT1G78750 45 / 4e-06 F-box/RNI-like superfamily protein (.1)
AT1G67390 45 / 9e-06 F-box family protein (.1)
AT3G03030 45 / 9e-06 F-box/RNI-like superfamily protein (.1)
AT5G22730 45 / 9e-06 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT5G56810 44 / 9e-06 F-box/RNI-like/FBD-like domains-containing protein (.1)
AT4G13985 44 / 1e-05 FBD1 FBD-associated F-box protein (.1)
AT5G44940 44 / 1e-05 F-box/RNI-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004851 114 / 1e-30 AT1G13570 139 / 7e-37 F-box/RNI-like superfamily protein (.1)
Lus10004852 88 / 1e-20 AT1G13570 147 / 6e-39 F-box/RNI-like superfamily protein (.1)
Lus10011048 71 / 5e-15 AT1G13570 127 / 2e-32 F-box/RNI-like superfamily protein (.1)
Lus10028366 69 / 2e-14 AT1G13570 98 / 4e-23 F-box/RNI-like superfamily protein (.1)
Lus10041818 69 / 3e-14 AT1G13570 154 / 3e-42 F-box/RNI-like superfamily protein (.1)
Lus10020636 60 / 1e-12 AT5G56810 52 / 2e-09 F-box/RNI-like/FBD-like domains-containing protein (.1)
Lus10020634 59 / 6e-12 AT4G14103 57 / 1e-10 F-box/RNI-like superfamily protein (.1.2)
Lus10020635 59 / 6e-12 AT4G14103 57 / 1e-10 F-box/RNI-like superfamily protein (.1.2)
Lus10020637 55 / 2e-09 AT3G58940 47 / 3e-06 F-box/RNI-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G107600 65 / 8e-13 AT1G13570 196 / 4e-58 F-box/RNI-like superfamily protein (.1)
Potri.014G039700 49 / 3e-07 AT1G13570 265 / 7e-85 F-box/RNI-like superfamily protein (.1)
Potri.002G132400 45 / 5e-06 AT1G13570 251 / 3e-79 F-box/RNI-like superfamily protein (.1)
Potri.013G146800 44 / 2e-05 AT1G69630 71 / 5e-13 F-box/RNI-like superfamily protein (.1)
Potri.001G322900 42 / 0.0001 AT3G18150 166 / 1e-45 RNI-like superfamily protein (.1)
Potri.011G024600 41 / 0.0001 AT4G26350 95 / 9e-21 F-box/RNI-like/FBD-like domains-containing protein (.1)
Potri.010G134200 40 / 0.0002 AT1G13570 526 / 0.0 F-box/RNI-like superfamily protein (.1)
Potri.015G011200 40 / 0.0002 AT4G03220 90 / 1e-19 Protein with RNI-like/FBD-like domains (.1)
Potri.014G163866 39 / 0.0008 AT4G14103 79 / 2e-16 F-box/RNI-like superfamily protein (.1.2)
Potri.001G337200 39 / 0.001 AT5G22660 86 / 6e-19 FBD, F-box, Skp2-like and Leucine Rich Repeat domains containing protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10004848 pacid=23157178 polypeptide=Lus10004848 locus=Lus10004848.g ID=Lus10004848.BGIv1.0 annot-version=v1.0
ATGGCAGGAAATTCCATAGACAGGATCAGCAGCACCTTACCAGACGATGTTAGGTTGCAGATACTCATGTACTTACCGTTACTCGACGCAGCCAAGTCCA
GCATCCTGTCGTCCAAATTGAGGAACCTGTGGACTAATCTCCCAACTCTGGTGATCGACGAAAGTTTTGGTGACGCTACTTATAAGCAAGAACTACAAGA
TAGAAGTCGTCCTTATCAGATCGATCACGTCTCGTCGTTCCTCCCTTTCAATACTCTCGAGAATCTAACCCTGGAAGGATTCTGCAAGTTGTCAGAGACC
GTGTTCTCCTCAATTTCGCGGCTCGAAACGCTGCGCCTGTCTTTCAGTACGTTCGTAGTCCCCTGTGTTTCGTTTGAGGGGTTCGATAGTTTGGCTGTTC
TCGAGATTCGTCACGTGTCGTTTCCTCGCGACGGGTTTGATCAAAATCACCTAGGGAGCCGTGGATGA
AA sequence
>Lus10004848 pacid=23157178 polypeptide=Lus10004848 locus=Lus10004848.g ID=Lus10004848.BGIv1.0 annot-version=v1.0
MAGNSIDRISSTLPDDVRLQILMYLPLLDAAKSSILSSKLRNLWTNLPTLVIDESFGDATYKQELQDRSRPYQIDHVSSFLPFNTLENLTLEGFCKLSET
VFSSISRLETLRLSFSTFVVPCVSFEGFDSLAVLEIRHVSFPRDGFDQNHLGSRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27750 F-box/FBD-like domains contain... Lus10004848 0 1
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10012508 2.6 0.7159
AT1G79800 AtENODL7 early nodulin-like protein 7 (... Lus10024846 3.2 0.6836
AT1G25275 unknown protein Lus10004192 10.8 0.6681
AT5G12390 FIS1B FISSION 1B, Tetratricopeptide ... Lus10009707 16.2 0.6015
AT5G59190 subtilase family protein (.1) Lus10040251 16.3 0.6683
AT1G06640 2-oxoglutarate (2OG) and Fe(II... Lus10013314 17.0 0.6514
Lus10034814 19.0 0.6083
AT1G43650 nodulin MtN21 /EamA-like trans... Lus10018890 31.4 0.5325
AT5G42905 Polynucleotidyl transferase, r... Lus10007550 32.8 0.5608
AT3G04380 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-dom... Lus10008198 36.1 0.5506

Lus10004848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.