Lus10004855 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02335 113 / 4e-31 GL22 germin-like protein subfamily 2 member 2 precursor (.1)
AT1G18980 108 / 2e-29 RmlC-like cupins superfamily protein (.1)
AT1G09560 107 / 9e-29 GLP5 germin-like protein 5 (.1)
AT1G18970 105 / 4e-28 GLP4 germin-like protein 4 (.1)
AT4G14630 102 / 5e-27 GLP9 germin-like protein 9 (.1)
AT5G26700 99 / 2e-25 RmlC-like cupins superfamily protein (.1)
AT5G38910 98 / 4e-25 RmlC-like cupins superfamily protein (.1)
AT3G62020 98 / 4e-25 GLP10 germin-like protein 10 (.1.2)
AT5G39110 97 / 5e-25 RmlC-like cupins superfamily protein (.1)
AT3G10080 97 / 8e-25 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004856 343 / 8e-122 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004854 326 / 6e-115 AT1G02335 137 / 2e-40 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10020632 310 / 4e-109 AT1G02335 129 / 1e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10020631 214 / 4e-71 AT3G10080 132 / 7e-39 RmlC-like cupins superfamily protein (.1)
Lus10004857 209 / 7e-69 AT1G02335 140 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004858 193 / 2e-62 AT1G02335 123 / 7e-35 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10034191 192 / 4e-62 AT1G18970 136 / 4e-40 germin-like protein 4 (.1)
Lus10043393 169 / 2e-53 AT1G18970 123 / 3e-35 germin-like protein 4 (.1)
Lus10030047 108 / 2e-29 AT3G05950 256 / 7e-87 RmlC-like cupins superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G157100 260 / 5e-89 AT1G09560 105 / 3e-28 germin-like protein 5 (.1)
Potri.004G194600 251 / 2e-85 AT3G62020 129 / 4e-37 germin-like protein 10 (.1.2)
Potri.010G240700 215 / 4e-71 AT1G02335 141 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.010G240600 213 / 2e-70 AT3G62020 112 / 3e-31 germin-like protein 10 (.1.2)
Potri.008G016700 209 / 4e-69 AT1G18980 122 / 6e-35 RmlC-like cupins superfamily protein (.1)
Potri.008G084300 204 / 5e-67 AT1G02335 147 / 3e-44 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.010G240500 203 / 1e-66 AT3G04200 123 / 5e-35 RmlC-like cupins superfamily protein (.1)
Potri.013G116500 177 / 2e-56 AT1G18970 70 / 1e-14 germin-like protein 4 (.1)
Potri.001G465100 114 / 1e-31 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3)
Potri.013G000500 111 / 2e-30 AT1G09560 311 / 1e-108 germin-like protein 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10004855 pacid=23157191 polypeptide=Lus10004855 locus=Lus10004855.g ID=Lus10004855.BGIv1.0 annot-version=v1.0
ATGGCTTCTCCAACTTCCACAATGAAGCTCCTTTTCCTAATCATAGCTTCTTTTGCCTCAATCCAAATGGCGATTTCCGGCGATCCGGATATCCTTACCG
ACTTCGTAGCCCCACCAAATACTGTTATTGATGGTTCGTTCTTCACTTTCAGAGGATTCCAGTTCCTAGTCAATGGCACGCAGCTGTCTCCTACGTTCAA
AGTTGTGAAGGCAACTAAGGCTGAGTTCCCTGCATTGGACGGGCAGAGTGTCTCGTATGCTACGCTCTTGTTCCCATCTGGGACGACCAACCCACCTCAC
ACCCATCCTCGCGCCTCTGAGCTCCTCTTCGTCCTTGATGGGTCGCTCCAGGTTGGATTTGTCGACACCACCAACAAGCTCTTCACCCAAACATTGCAGG
TGGGTGACATGTTCGTATTCCCCAAGGGACTTGTTCACTTCCAATACAACGCCGGGAATGGTACCGCAATAGCTATCTCCGCATTCGGGAGTGCGAGTGC
AGGAACAGTGTCGCTTCCCGGGACACTCTTCGCGACCAACATCGATGACACCGTATTGGCTAAGTCTTTCAAGACTGATGTCTCTGTTATTCAAGGTCTC
AAGGCTGGCCTAAAGGCCTAG
AA sequence
>Lus10004855 pacid=23157191 polypeptide=Lus10004855 locus=Lus10004855.g ID=Lus10004855.BGIv1.0 annot-version=v1.0
MASPTSTMKLLFLIIASFASIQMAISGDPDILTDFVAPPNTVIDGSFFTFRGFQFLVNGTQLSPTFKVVKATKAEFPALDGQSVSYATLLFPSGTTNPPH
THPRASELLFVLDGSLQVGFVDTTNKLFTQTLQVGDMFVFPKGLVHFQYNAGNGTAIAISAFGSASAGTVSLPGTLFATNIDDTVLAKSFKTDVSVIQGL
KAGLKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02335 GL22 germin-like protein subfamily ... Lus10004855 0 1
AT1G27220 paired amphipathic helix repea... Lus10000805 3.9 0.8835
AT1G32910 HXXXD-type acyl-transferase fa... Lus10006333 4.4 0.7631
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10030286 5.5 0.8835
AT5G27750 F-box/FBD-like domains contain... Lus10035326 5.6 0.6388
AT5G55930 ATOPT1 ARABIDOPSIS THALIANA OLIGOPEPT... Lus10004237 5.8 0.8019
Lus10033096 6.7 0.8835
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Lus10023434 6.8 0.6920
Lus10017410 7.3 0.7925
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10021338 7.7 0.8835
Lus10005203 8.1 0.6942

Lus10004855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.