Lus10004857 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02335 130 / 7e-38 GL22 germin-like protein subfamily 2 member 2 precursor (.1)
AT1G18970 123 / 2e-35 GLP4 germin-like protein 4 (.1)
AT3G10080 120 / 4e-34 RmlC-like cupins superfamily protein (.1)
AT1G09560 120 / 5e-34 GLP5 germin-like protein 5 (.1)
AT1G18980 119 / 1e-33 RmlC-like cupins superfamily protein (.1)
AT3G04200 118 / 3e-33 RmlC-like cupins superfamily protein (.1)
AT3G05950 115 / 4e-32 RmlC-like cupins superfamily protein (.1)
AT5G39110 113 / 2e-31 RmlC-like cupins superfamily protein (.1)
AT5G39150 113 / 2e-31 RmlC-like cupins superfamily protein (.1)
AT5G39120 113 / 2e-31 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020631 322 / 5e-114 AT3G10080 132 / 7e-39 RmlC-like cupins superfamily protein (.1)
Lus10004856 222 / 4e-74 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004854 221 / 6e-74 AT1G02335 137 / 2e-40 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10004855 221 / 1e-73 AT1G02335 129 / 3e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10020632 218 / 1e-72 AT1G02335 129 / 1e-37 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10034191 184 / 3e-59 AT1G18970 136 / 4e-40 germin-like protein 4 (.1)
Lus10004858 184 / 3e-59 AT1G02335 123 / 7e-35 germin-like protein subfamily 2 member 2 precursor (.1)
Lus10043393 169 / 1e-53 AT1G18970 123 / 3e-35 germin-like protein 4 (.1)
Lus10009254 116 / 2e-32 AT3G62020 306 / 1e-106 germin-like protein 10 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G194600 229 / 6e-77 AT3G62020 129 / 4e-37 germin-like protein 10 (.1.2)
Potri.009G157100 225 / 1e-75 AT1G09560 105 / 3e-28 germin-like protein 5 (.1)
Potri.008G016700 220 / 9e-74 AT1G18980 122 / 6e-35 RmlC-like cupins superfamily protein (.1)
Potri.010G240500 220 / 2e-73 AT3G04200 123 / 5e-35 RmlC-like cupins superfamily protein (.1)
Potri.010G240700 218 / 6e-73 AT1G02335 141 / 4e-42 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.008G084300 217 / 2e-72 AT1G02335 147 / 3e-44 germin-like protein subfamily 2 member 2 precursor (.1)
Potri.010G240600 207 / 2e-68 AT3G62020 112 / 3e-31 germin-like protein 10 (.1.2)
Potri.013G116500 159 / 9e-50 AT1G18970 70 / 1e-14 germin-like protein 4 (.1)
Potri.013G000500 123 / 2e-35 AT1G09560 311 / 1e-108 germin-like protein 5 (.1)
Potri.002G184900 118 / 2e-33 AT3G62020 332 / 3e-117 germin-like protein 10 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF00190 Cupin_1 Cupin
Representative CDS sequence
>Lus10004857 pacid=23157148 polypeptide=Lus10004857 locus=Lus10004857.g ID=Lus10004857.BGIv1.0 annot-version=v1.0
ATGGCTGCAGATCCAGACATCCTCACAGACTTCATCCTCCCACAAAACTCAACAACGAACACCACAAGCCAGTTCTTCACATTCTCCGGCATGAGGCCAA
TCTTCCATCAAAGACCACAAGGCTTCACCATTTCCAAGGCCAGCCTAGCCCAATTCCCAGCTCTCGAAGGCCAGAGCGTCTCCTACGCTGTCCTCCAATT
CCCTTCAGGTACCACCAACCCTCCACACATCCACCCTCGAGCATCCGAGCTGCTCTTCCTCGCCCGCGGCAGCCTCCAAGTAGGGTTCGTTGACACCGCC
AACAAGCTCTACACTCAGACTCTGGAGCTCGGTGACATGTTCGTGTTCCCTAAGGGTCTAGTCCACTTCCAGCACAATGTTGGGAAAGTTACTGCAGTTG
CATTCTCTGCCTTTGGAAGTGCCAATGCTGGAACTGTTTCTCTCCCACCTACTCTGTTCACCAGTGGGATTGATGATGATGTTTTGGTTAAAGGGTTCAA
GAGCGATGTCACTACTATTCAGTCTCTCAAGGCTGGCCTTTCTGCTAAGAAATGA
AA sequence
>Lus10004857 pacid=23157148 polypeptide=Lus10004857 locus=Lus10004857.g ID=Lus10004857.BGIv1.0 annot-version=v1.0
MAADPDILTDFILPQNSTTNTTSQFFTFSGMRPIFHQRPQGFTISKASLAQFPALEGQSVSYAVLQFPSGTTNPPHIHPRASELLFLARGSLQVGFVDTA
NKLYTQTLELGDMFVFPKGLVHFQHNVGKVTAVAFSAFGSANAGTVSLPPTLFTSGIDDDVLVKGFKSDVTTIQSLKAGLSAKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02335 GL22 germin-like protein subfamily ... Lus10004857 0 1
AT2G01770 ATVIT1, VIT1 vacuolar iron transporter 1 (.... Lus10003704 1.4 0.8906
AT1G17930 Aminotransferase-like, plant m... Lus10011644 4.1 0.8950
Lus10005297 7.9 0.8561
AT4G24204 RING/U-box superfamily protein... Lus10010392 8.4 0.7469
Lus10013260 9.2 0.8561
AT5G54010 UDP-Glycosyltransferase superf... Lus10003154 9.5 0.7610
AT1G01420 UGT72B3 UDP-glucosyl transferase 72B3 ... Lus10001905 9.9 0.8554
AT3G13790 ATCWINV1, ATBFR... ARABIDOPSIS THALIANA CELL WALL... Lus10015614 10.2 0.8561
AT5G53910 RING/U-box superfamily protein... Lus10011380 11.2 0.8561
AT5G48380 BIR1 BAK1-interacting receptor-like... Lus10036704 12.0 0.8347

Lus10004857 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.