Lus10004870 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27510 165 / 4e-53 ATFD3 ferredoxin 3 (.1)
AT1G60950 140 / 4e-43 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT1G10960 134 / 9e-41 ATFD1 ferredoxin 1 (.1)
AT5G10000 122 / 2e-36 ATFD4 ferredoxin 4 (.1)
AT4G14890 91 / 7e-24 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
AT1G32550 72 / 2e-16 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020616 295 / 2e-104 AT2G27510 172 / 9e-56 ferredoxin 3 (.1)
Lus10034144 169 / 3e-54 AT2G27510 179 / 1e-58 ferredoxin 3 (.1)
Lus10043430 167 / 8e-54 AT2G27510 179 / 3e-58 ferredoxin 3 (.1)
Lus10015462 134 / 1e-40 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10001369 131 / 1e-39 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10006116 87 / 2e-22 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10010557 89 / 4e-22 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10000483 70 / 2e-15 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Lus10004576 70 / 3e-15 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G202500 187 / 1e-61 AT2G27510 164 / 3e-52 ferredoxin 3 (.1)
Potri.009G163800 184 / 9e-61 AT2G27510 167 / 7e-54 ferredoxin 3 (.1)
Potri.008G020100 167 / 7e-54 AT2G27510 180 / 5e-59 ferredoxin 3 (.1)
Potri.010G239100 166 / 2e-53 AT2G27510 175 / 7e-57 ferredoxin 3 (.1)
Potri.004G218400 141 / 9e-44 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G015200 140 / 3e-43 AT1G60950 176 / 2e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.001G470700 134 / 6e-41 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.010G087300 91 / 4e-24 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.008G153200 91 / 7e-24 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.003G090400 67 / 2e-14 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0486 Fer2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence
>Lus10004870 pacid=23157172 polypeptide=Lus10004870 locus=Lus10004870.g ID=Lus10004870.BGIv1.0 annot-version=v1.0
ATGGCAACGGCAGCCGCAACAGTTCTCTCCCAAACCGTTATCACATCCGGGATCGAAAAAAGATTCACGAGCTCAGTTTTCAATCCGGTGAACGCTATTG
TGCCAGCGAGGAGCACTGTCTCGAAGCCGTTGGGGTTGAAATTCAGCCGAAGCTTGACAGTGTGCAATGCGGTCTACAAAGTGAAGCTTGTGGGACCGGA
CGGTGCAAACACAGAGTTCGAATGTGCGGACGACACCTACATTCTCGACGCGGCAGAGGAGGCGGGAGCGGACCTGCCTTACTCGTGCAGGGCCGGTGCT
TGCTGCACCTGTGCCGGGAAACTGGTTTCGGGATCGGTTGACCAGTCGGATGGGTCGTTCTTGGACGAGAATCAGATGAAGGACGGGTATCTCCTCACTT
GCGTCTCGTACCCGACTGCGGACTGTGAGATCCACACTCACAAGGAGGAAGAGCTCATGTAA
AA sequence
>Lus10004870 pacid=23157172 polypeptide=Lus10004870 locus=Lus10004870.g ID=Lus10004870.BGIv1.0 annot-version=v1.0
MATAAATVLSQTVITSGIEKRFTSSVFNPVNAIVPARSTVSKPLGLKFSRSLTVCNAVYKVKLVGPDGANTEFECADDTYILDAAEEAGADLPYSCRAGA
CCTCAGKLVSGSVDQSDGSFLDENQMKDGYLLTCVSYPTADCEIHTHKEEELM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10004870 0 1
AT5G62790 PDE129, DXR PIGMENT-DEFECTIVE EMBRYO 129, ... Lus10002379 2.0 0.9763
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10001491 2.2 0.9667
AT4G35160 O-methyltransferase family pro... Lus10015311 3.0 0.9704
AT2G26930 CMK, CMEK, ISPE... PIGMENT DEFECTIVE 277, 4-\(cyt... Lus10036098 3.5 0.9680
AT4G19880 Glutathione S-transferase fami... Lus10036209 3.7 0.9709
AT5G51460 ATTPPA Haloacid dehalogenase-like hyd... Lus10031146 5.7 0.9619
AT5G60600 HDS, ISPG, CSB3... CONSTITUTIVE SUBTILISIN 3, CHL... Lus10021480 6.5 0.9649
AT3G51520 diacylglycerol acyltransferase... Lus10039135 6.9 0.9572
AT5G23160 unknown protein Lus10010194 8.0 0.9531
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Lus10023024 8.0 0.9366

Lus10004870 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.