Lus10004871 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08360 0 / 1 Ribosomal protein L1p/L10e family (.1)
AT2G27530 0 / 1 PGY1 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
AT5G22440 0 / 1 Ribosomal protein L1p/L10e family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037074 301 / 3e-98 AT2G03590 575 / 0.0 ureide permease 1 (.1)
Lus10020615 0 / 1 AT2G27530 313 / 1e-107 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Lus10026664 0 / 1 AT2G03510 537 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004648 0 / 1 AT2G03510 541 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10036911 0 / 1 AT2G03530 575 / 0.0 ARABIDOPSIS THALIANA UREIDE PERMEASE 2, ureide permease 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G034800 203 / 7e-66 AT2G27530 338 / 2e-119 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Potri.004G202832 203 / 9e-66 AT2G27530 337 / 7e-119 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Potri.007G035600 202 / 2e-65 AT2G27530 339 / 9e-120 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Potri.004G202766 196 / 5e-63 AT1G08360 336 / 1e-118 Ribosomal protein L1p/L10e family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Representative CDS sequence
>Lus10004871 pacid=23157145 polypeptide=Lus10004871 locus=Lus10004871.g ID=Lus10004871.BGIv1.0 annot-version=v1.0
ATGAGTAAGCTGCAGAGTGAGACACTGAGAGAAGCCATCTCAGCCATCAAAGCCGCTGCTAACGAAAAGCCTCGCAAGTTCACCGAGACAGTCGAGTTAC
AGATTGGGTTGAAGAACTATGACCCCCAGAAAGACAAGCGTTTCAGCGGCTCAGTTAAGTTGCCTCACATCCCTCGCCCCAAGATGAAGGTCTGCATGCT
CGGCGATGCCCAGCACGTCGAAGAGGCGAATGCAATGGGACTGCAATCCATGGATGTGGAAAGCTTGAAGAAGCTGAACAAGAATAAGAAACTGGTTAAG
AAGCTAGCAAAGTCTTACCATGCTTTCCTGGCTTCTGAGTCTGTTATCAAGCAGATTCCCCGTCTTCTAGGCCCCGGTCTCAACAAGGCAGGCAAGAAAG
TTCCCAACTCTTGTGAGTCATCAGGAATCCCTGGAGTCGAAGGTGAACGAGATCAAGGCAACCGTGAAATTCCAGCTGAAGAAGGTTCTGTGCATGGGAG
TTGCAGTAGGAAACCTCGATATGGACGAGAAGCAGATCTTCCAGAATGTGCAAATGAGCATCAACTTCCTTGTTTCCCTACTGAAGAAGAATTGGCAGAA
CGTGAAAGTGTTGAACTTGAAGAGTACAATGGGGAAACCACAAAGCATCTTCTGAGAAGGTTTCTGTGGGACAAGATTGGGACTTTTTGGGTTTTGAGTG
TAACGGTTAGAGAACTATAG
AA sequence
>Lus10004871 pacid=23157145 polypeptide=Lus10004871 locus=Lus10004871.g ID=Lus10004871.BGIv1.0 annot-version=v1.0
MSKLQSETLREAISAIKAAANEKPRKFTETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEANAMGLQSMDVESLKKLNKNKKLVK
KLAKSYHAFLASESVIKQIPRLLGPGLNKAGKKVPNSCESSGIPGVEGERDQGNREIPAEEGSVHGSCSRKPRYGREADLPECANEHQLPCFPTEEELAE
RESVELEEYNGETTKHLLRRFLWDKIGTFWVLSVTVREL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27530 PGY1 PIGGYBACK1, Ribosomal protein ... Lus10004871 0 1
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10029879 2.4 0.8858
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10009578 2.6 0.9049
AT4G31985 Ribosomal protein L39 family p... Lus10019065 3.9 0.8434
AT4G30930 WRKY32, NFD1 NUCLEAR FUSION DEFECTIVE 1, Ri... Lus10015441 8.2 0.8700
AT3G12150 unknown protein Lus10035501 10.4 0.8567
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10020794 10.5 0.8720
AT5G47680 AtTRM, TRM10 tRNA modification 10, unknown ... Lus10039081 14.0 0.8435
AT2G27710 60S acidic ribosomal protein f... Lus10043377 15.5 0.8574
AT3G16080 Zinc-binding ribosomal protein... Lus10035878 15.9 0.8574
AT5G09510 Ribosomal protein S19 family p... Lus10018777 17.7 0.8511

Lus10004871 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.