Lus10004885 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21720 357 / 2e-127 PBC1 proteasome beta subunit C1 (.1)
AT1G77440 352 / 1e-125 PBC2 20S proteasome beta subunit C2 (.1.2)
AT3G60820 72 / 1e-15 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT4G31300 42 / 0.0001 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020599 396 / 5e-143 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1)
Lus10015867 77 / 2e-17 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10009294 74 / 2e-15 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Lus10006426 63 / 7e-12 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10011369 63 / 7e-12 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G180500 356 / 4e-127 AT1G21720 391 / 9e-141 proteasome beta subunit C1 (.1)
Potri.002G080800 352 / 9e-126 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1)
Potri.002G148300 72 / 1e-15 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.014G069800 69 / 2e-14 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.008G177000 66 / 6e-13 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.018G145900 42 / 6e-05 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.006G077900 39 / 0.0007 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Lus10004885 pacid=23157176 polypeptide=Lus10004885 locus=Lus10004885.g ID=Lus10004885.BGIv1.0 annot-version=v1.0
ATGGTGGGGAAGAACTGCTTCGCCATAGCTAGCGATCGCCGATTGGGAGTCCAGCTCCAGACCGTCGCCACGGATTTCCAGCGCATCTATAAAATTCACG
ACAAGCTCTTCTTCGGGCTTTCTGGATTGGCCTCCGACGCTCAGACTTTGCATCAGAGGCTGATGTTTCGCCATAAGCTGTATCAGCTGAGGGAAGAGAG
GGATATGAAGCCTGAGACTTTCTCCAGCCTTGTCTCCGCTATTCTTTATGAGAAAAGGTTTGGTCCATATTTCGTCCAACCTGTAATTGCTGGACTAAGC
GATGATGATCAGCCATTCATTTGTACGATGGATTCTATTGGTGCCAAGGAATTGGCAAAAGATTTTGTCGTCGGAGGCACAGCTGGAGAGTCTCTTTATG
GTGCTTGTGAGGCAATGTTCAAGCCTGACATGGAACCTGAGGAGTTATTCGAGACTCTCTCGCAAGCACTTCTGGCTTCAGTGGATCGGGATTGTCTAAG
TGGATGGGGAGGACACATCTATCTTGTTACCCCGACTGAGATCAAAGAATGCACCTTGAAGGGAAGGATGGACTGA
AA sequence
>Lus10004885 pacid=23157176 polypeptide=Lus10004885 locus=Lus10004885.g ID=Lus10004885.BGIv1.0 annot-version=v1.0
MVGKNCFAIASDRRLGVQLQTVATDFQRIYKIHDKLFFGLSGLASDAQTLHQRLMFRHKLYQLREERDMKPETFSSLVSAILYEKRFGPYFVQPVIAGLS
DDDQPFICTMDSIGAKELAKDFVVGGTAGESLYGACEAMFKPDMEPEELFETLSQALLASVDRDCLSGWGGHIYLVTPTEIKECTLKGRMD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10004885 0 1
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10041296 1.0 0.8888
AT5G04940 SUVH1 SU(VAR)3-9 homolog 1 (.1), SU(... Lus10008680 2.0 0.8622
AT4G13520 SMAP1 small acidic protein 1 (.1) Lus10023702 2.4 0.8530
AT3G25545 unknown protein Lus10029095 2.8 0.8399
AT3G17120 unknown protein Lus10010906 3.7 0.7835
AT1G07020 unknown protein Lus10042256 4.9 0.7931
AT1G31817 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ri... Lus10012155 5.0 0.8069
AT1G30580 GTP binding (.1) Lus10023261 5.2 0.7622
AT5G20920 EIF2 BETA, EMB1... embryo defective 1401, eukaryo... Lus10012186 6.9 0.7749
AT5G66140 PAD2 proteasome alpha subunit D2 (.... Lus10028437 11.0 0.7235

Lus10004885 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.