Gene [FLAX] | FIBexDB

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TAIR10 short description
AT1G06620	364 / 8e-125	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650	345 / 3e-117	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G30830	336 / 8e-114	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540	333 / 1e-112	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350	332 / 2e-112	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530	330 / 2e-111	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640	325 / 3e-109	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT1G06645	321 / 6e-108	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840	317 / 2e-106	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G61400	315 / 2e-105	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10021943 [exp]	398 / 4e-138	AT1G06620	443 / 5e-156	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 [exp]	397 / 8e-138	AT1G06620	432 / 1e-151	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 [exp]	397 / 2e-137	AT1G06620	429 / 3e-150	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 [exp]	393 / 3e-136	AT1G06620	416 / 2e-145	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 [exp]	391 / 2e-135	AT5G59530	420 / 5e-147	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022197 [exp]	389 / 1e-134	AT1G06620	434 / 6e-153	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 [exp]	384 / 2e-132	AT1G06620	432 / 6e-152	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 [exp]	374 / 8e-129	AT1G06620	456 / 3e-161	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 [exp]	371 / 1e-127	AT1G06620	442 / 4e-156	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.010G073166 [exp]	398 / 3e-138	AT1G06620	470 / 7e-167	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 [exp]	385 / 4e-133	AT1G06620	402 / 7e-140	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 [exp]	368 / 3e-126	AT1G06620	455 / 7e-161	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 [exp]	347 / 3e-118	AT1G06650	430 / 7e-151	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.008G165400 [exp]	337 / 5e-114	AT1G06620	444 / 1e-156	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 [exp]	325 / 3e-109	AT1G06650	414 / 2e-144	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 [exp]	300 / 1e-99	AT1G06620	369 / 6e-127	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 [exp]	298 / 1e-98	AT1G06620	323 / 1e-108	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 [exp]	296 / 7e-98	AT1G06620	330 / 2e-111	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 [exp]	282 / 1e-92	AT1G06620	340 / 3e-115	2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)

PFAM info

Clan ID	Clan name	Pfam ID	Pfam name	Pfam description
CL0029 [flax] [poplar]	Cupin	PF03171 [flax] [poplar]	2OG-FeII_Oxy	2OG-Fe(II) oxygenase superfamily

Representative CDS sequence

Show only first row Show all

>Lus10004888 pacid=23157179 polypeptide=Lus10004888 locus=Lus10004888.g ID=Lus10004888.BGIv1.0 annot-version=v1.0

ATGGCTCCCACCTCTGCCGCCGATCAGCCGCTTACCAATTACGATCGCCTAGCCGAGCTCAAGGCTTTCGACGAGACGAAAGCCGGAGTGAAAGGCCTAG

TCGACTCCGGAATCAACCACGTCCCTCGAATTTTCCACAACCCACCAAACCAAAAAATTATAGGACAACAACCGCCGCCGGTTTCATTTTCCGACGATCG

AGACTTCCGGCCGCCGGTCATAAATTTCGCCGGAATAGGCGGAGGCGACGACGAGAAGATGAGAAAGGAAATGGTGGAAGAAATCAGGGATGCGGCGGGG

GAGTGGGGGTTCTTCCAAGTGGTGAACCACGGAATTCCGGCAAGAGTAACTGCGGAGATGGCCGCCGGAGTTGTGAGGTTCTTTGAGATGGCCGTCGATG

AGAAGAAGGAGTACTTCAGTAGGGATTTTCGGAAGAAGAAGGTTCGTTACAATAGTAACTATGATTTGTACACTTCCCATGCTGCCAGCTGGAGGGACTC

CATTGGGTTCGAAATGGCCCCGGTCCTGCCCGAACCGGTCGAGTTTCCGGGTTGCTCCAGGGAAATCGTGATGGAGTACGCGAATGAAATGAAGAAACTC

GGGGACTTACTTCTTACTCTGTTGTCCGAGGCTCTAGGTCTCGACTCGAATCACCTGATCGAATTAGAATGTGCGAAAGGGTTAACCTTGGTGGGTCATT

ACTACCCACCATGCCCCCAACCAGAGCTAACTATGGGGACAAGGATGCATCAAGATGACAGCTTCTTCACTGTGATTCAACAAGATCATATTGGTGGACT

TCAAGTTCTTCACGATGACAAGTTAGTTGATTTAACTCCTACACCGGGCGCTCTTGTGGTAAATATTGGGAATTTACTCCAGTTGGTGTCAAACGACAAG

TTCATAAGTTCGGAGCACAGGGTGCTAGCGAACCGGGTCGGACCAAGAGTCTCGATAGGGTCATTTTTCAGCACGGAAAATGTACTATCGAACCCGAGGA

TGTACGAACCGATCAAGGAGCTGTTATCGGAGAAGGATCGTCCGAAGTACAAGAAGGTATCAGTTCAAGATTATCAAGCAAAGTTCCACAGTGAGGGTCT

CAATGGGACTTCTGCTTTGCTTCACTTCCAGCTCTAA

AA sequence

Show only first row Show all

>Lus10004888 pacid=23157179 polypeptide=Lus10004888 locus=Lus10004888.g ID=Lus10004888.BGIv1.0 annot-version=v1.0

MAPTSAADQPLTNYDRLAELKAFDETKAGVKGLVDSGINHVPRIFHNPPNQKIIGQQPPPVSFSDDRDFRPPVINFAGIGGGDDEKMRKEMVEEIRDAAG

EWGFFQVVNHGIPARVTAEMAAGVVRFFEMAVDEKKEYFSRDFRKKKVRYNSNYDLYTSHAASWRDSIGFEMAPVLPEPVEFPGCSREIVMEYANEMKKL

GDLLLTLLSEALGLDSNHLIELECAKGLTLVGHYYPPCPQPELTMGTRMHQDDSFFTVIQQDHIGGLQVLHDDKLVDLTPTPGALVVNIGNLLQLVSNDK

FISSEHRVLANRVGPRVSIGSFFSTENVLSNPRMYEPIKELLSEKDRPKYKKVSVQDYQAKFHSEGLNGTSALLHFQL

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10004888 [exp]	0	1

Lus10004888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.

Plant FIBer expression Database

Lus10004888 [FLAX]

DESeq2's median of ratios [FLAX]

Coexpressed genes

Lus10004888 coexpression network