Lus10004889 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G51200 54 / 5e-10 A20/AN1-like zinc finger family protein (.1.2.3.4)
AT3G52800 52 / 4e-09 A20/AN1-like zinc finger family protein (.1)
AT2G36320 52 / 4e-09 A20/AN1-like zinc finger family protein (.1)
AT2G27580 50 / 2e-08 A20/AN1-like zinc finger family protein (.1.2)
AT4G12040 47 / 2e-07 AtSAP7 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
AT1G12440 46 / 4e-07 A20/AN1-like zinc finger family protein (.1.2)
AT4G22820 46 / 5e-07 A20/AN1-like zinc finger family protein (.1.2)
AT3G12630 45 / 1e-06 SAP5 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
AT4G25380 40 / 6e-05 AtSAP10, SAP10 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020594 90 / 1e-23 AT2G36320 149 / 2e-46 A20/AN1-like zinc finger family protein (.1)
Lus10035603 52 / 2e-09 AT2G36320 152 / 3e-48 A20/AN1-like zinc finger family protein (.1)
Lus10003246 52 / 5e-09 AT2G36320 201 / 3e-67 A20/AN1-like zinc finger family protein (.1)
Lus10006671 51 / 6e-09 AT1G12440 204 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10031833 50 / 2e-08 AT1G51200 186 / 5e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10028903 49 / 4e-08 AT1G12440 205 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10008912 49 / 5e-08 AT1G12440 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2)
Lus10015697 47 / 2e-07 AT3G12630 178 / 1e-57 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Lus10031262 47 / 4e-07 AT1G51200 187 / 2e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G184300 54 / 4e-10 AT2G27580 156 / 4e-49 A20/AN1-like zinc finger family protein (.1.2)
Potri.009G144100 54 / 6e-10 AT2G27580 166 / 5e-53 A20/AN1-like zinc finger family protein (.1.2)
Potri.001G018600 52 / 2e-09 AT1G51200 203 / 2e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.003G205500 50 / 2e-08 AT1G51200 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.003G117100 50 / 2e-08 AT1G12440 170 / 2e-54 A20/AN1-like zinc finger family protein (.1.2)
Potri.001G269400 49 / 4e-08 AT3G12630 160 / 2e-50 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Potri.001G115000 49 / 7e-08 AT4G12040 169 / 4e-54 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.006G056500 47 / 1e-07 AT1G51200 167 / 2e-53 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.009G063900 47 / 2e-07 AT3G12630 166 / 5e-53 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Potri.016G051700 47 / 3e-07 AT1G51200 164 / 3e-52 A20/AN1-like zinc finger family protein (.1.2.3.4)
PFAM info
Representative CDS sequence
>Lus10004889 pacid=23157155 polypeptide=Lus10004889 locus=Lus10004889.g ID=Lus10004889.BGIv1.0 annot-version=v1.0
ATGGAGGTGGTGGTTGCGGCGGCGGTGGTTGCGGTTGCGGCTCCGGAGGTTGATATGGAGAAGAAGGATGTGTCGGTGGGGACGCAGCCCAACAGGTGCA
CCCAGTGCAATCGGCGCGTGGGGCTGACGGGGTTCAAGTGCAAGTGCGGGATGGTTTTCTGTGGCGGCGTGCGCACGGCGGGTGGTGCTGACGTGGTTCA
AGGGCAAGTGCGGGATGGTTTTCTGTGGCGGCCACCGGTACCCGGAGCTGCACGGGTGCAGCTTCGATTTCAAGACGTTGGGGAAGGAACAGATCGCCAA
GGAGAATCCGGTCGTCAAGGGGAAAAAGCTACGAAAGATCTGACGAGCTGA
AA sequence
>Lus10004889 pacid=23157155 polypeptide=Lus10004889 locus=Lus10004889.g ID=Lus10004889.BGIv1.0 annot-version=v1.0
MEVVVAAAVVAVAAPEVDMEKKDVSVGTQPNRCTQCNRRVGLTGFKCKCGMVFCGGVRTAGGADVVQGQVRDGFLWRPPVPGAARVQLRFQDVGEGTDRQ
GESGRQGEKATKDLTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G51200 A20/AN1-like zinc finger famil... Lus10004889 0 1
AT5G01710 methyltransferases (.1) Lus10022682 1.0 0.9150
AT2G36320 A20/AN1-like zinc finger famil... Lus10020594 2.6 0.8831
AT1G18740 Protein of unknown function (D... Lus10018883 3.2 0.9110
AT1G18740 Protein of unknown function (D... Lus10028578 5.9 0.8964
AT1G74450 Protein of unknown function (D... Lus10042809 6.3 0.9020
AT1G18740 Protein of unknown function (D... Lus10029782 7.3 0.8610
AT3G57450 unknown protein Lus10031071 9.5 0.8901
AT3G15040 Protein of unknown function, D... Lus10034190 12.3 0.8823
AT1G35830 VQ motif-containing protein (.... Lus10024738 14.3 0.8754
AT4G21350 PUB8, B80 plant U-box 8 (.1) Lus10020077 14.5 0.8682

Lus10004889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.