Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG01280 96 / 7e-25 ATCG01280.1, YCF2.2 Chloroplast Ycf2;ATPase, AAA type, core (.1) ATCG00860 96 / 7e-25 ATCG00860.1, YCF2.1 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G143400 [exp] 105 / 5e-28 ATCG01280 3894 / 0.0 Chloroplast Ycf2;ATPase, AAA type, core (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05695 [flax] [poplar] DUF825 Plant protein of unknown function (DUF825)
Representative CDS sequence Show only first row Show all	>Lus10004897 pacid=23178689 polypeptide=Lus10004897 locus=Lus10004897.g ID=Lus10004897.BGIv1.0 annot-version=v1.0 ATGGACGGACTATTCACGGAAGGTGAGAAGGAGATGAATAAGCATCTCCCTCCGGAAGAAATCGAAGAAGTTATTGGGAGTCCTACAATATCCATTCGTT CTTTTTTCTCTGACCCATTGTCAGAACTTCATCTGCGTTCGAATCCTCCGGGTAGGCCCGCTAGAGATCCGAAATTGTTGAAGAAAAAGAAAGAACAAGA TGTTTCTTTTGTCGCTTTGAGGCGAGCAGAACAGAAATAA
AA sequence Show only first row Show all	>Lus10004897 pacid=23178689 polypeptide=Lus10004897 locus=Lus10004897.g ID=Lus10004897.BGIv1.0 annot-version=v1.0 MDGLFTEGEKEMNKHLPPEEIEEVIGSPTISIRSFFSDPLSELHLRSNPPGRPARDPKLLKKKKEQDVSFVALRRAEQK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Lus10004897 [exp]	0	1
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Lus10002548 [exp]	1.0	0.9725
AT1G36160		GSD1, PAS3, GK,...	PASTICCINO 3, GLOSSYHEAD 1, GU...		Lus10024748 [exp]	1.7	0.9523
					Lus10026434 [exp]	2.0	0.9568
ATCG00500		ATCG00500.1, AC...	acetyl-CoA carboxylase carboxy...		Lus10002473 [exp]	3.5	0.9408
AT5G36000			unknown protein		Lus10035747 [exp]	5.5	0.9018
ATCG00670		PCLPP, ATCG0067...	CASEINOLYTIC PROTEASE P 1, pla...		Lus10006595 [exp]	5.9	0.9177
AT5G50920		CLPC1, CLPC, AT...	HEAT SHOCK PROTEIN 93-V, DE-RE...		Lus10032543 [exp]	7.4	0.8991
ATCG00180		ATCG00180.1, RP...	DNA-directed RNA polymerase fa...		Lus10009499 [exp]	7.7	0.9198
AT5G50920		CLPC1, CLPC, AT...	HEAT SHOCK PROTEIN 93-V, DE-RE...		Lus10043198 [exp]	8.5	0.8973
ATCG00830		ATCG00830.1, RP...	ribosomal protein L2 (.1)		Lus10001687 [exp]	10.8	0.9032

Compare expression of checked genes

Lus10004897 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.